PDB entry 5lfq

View 5lfq on RCSB PDB site
Description: crystal structure of the bacterial proteasome activator bpa of mycobacterium tuberculosis (space group p3)
Deposited on 2016-07-04, released 2016-11-23
The last revision was dated 2016-12-14, with a file datestamp of 2016-12-09.
Experiment type: XRAY
Resolution: 3.5 Å
R-factor: N/A
AEROSPACI score: 0.1 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Bacterial proteasome activator
    Species: MYCOBACTERIUM TUBERCULOSIS H37RV [TaxId:83332]
    Gene: bpa, Rv3780, MTCY13D12.14
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Bacterial proteasome activator
    Species: MYCOBACTERIUM TUBERCULOSIS H37RV [TaxId:83332]
    Gene: bpa, Rv3780, MTCY13D12.14
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: Bacterial proteasome activator
    Species: MYCOBACTERIUM TUBERCULOSIS H37RV [TaxId:83332]
    Gene: bpa, Rv3780, MTCY13D12.14
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: Bacterial proteasome activator
    Species: MYCOBACTERIUM TUBERCULOSIS H37RV [TaxId:83332]
    Gene: bpa, Rv3780, MTCY13D12.14
    Database cross-references and differences (RAF-indexed):
  • Chain 'E':
    Compound: Bacterial proteasome activator
    Species: MYCOBACTERIUM TUBERCULOSIS H37RV [TaxId:83332]
    Gene: bpa, Rv3780, MTCY13D12.14
    Database cross-references and differences (RAF-indexed):
  • Chain 'F':
    Compound: Bacterial proteasome activator
    Species: MYCOBACTERIUM TUBERCULOSIS H37RV [TaxId:83332]
    Gene: bpa, Rv3780, MTCY13D12.14
    Database cross-references and differences (RAF-indexed):
  • Chain 'G':
    Compound: Bacterial proteasome activator
    Species: MYCOBACTERIUM TUBERCULOSIS H37RV [TaxId:83332]
    Gene: bpa, Rv3780, MTCY13D12.14
    Database cross-references and differences (RAF-indexed):
  • Chain 'H':
    Compound: Bacterial proteasome activator
    Species: MYCOBACTERIUM TUBERCULOSIS H37RV [TaxId:83332]
    Gene: bpa, Rv3780, MTCY13D12.14
    Database cross-references and differences (RAF-indexed):
  • Chain 'I':
    Compound: Bacterial proteasome activator
    Species: MYCOBACTERIUM TUBERCULOSIS H37RV [TaxId:83332]
    Gene: bpa, Rv3780, MTCY13D12.14
    Database cross-references and differences (RAF-indexed):
  • Chain 'J':
    Compound: Bacterial proteasome activator
    Species: MYCOBACTERIUM TUBERCULOSIS H37RV [TaxId:83332]
    Gene: bpa, Rv3780, MTCY13D12.14
    Database cross-references and differences (RAF-indexed):
  • Chain 'K':
    Compound: Bacterial proteasome activator
    Species: MYCOBACTERIUM TUBERCULOSIS H37RV [TaxId:83332]
    Gene: bpa, Rv3780, MTCY13D12.14
    Database cross-references and differences (RAF-indexed):
  • Chain 'L':
    Compound: Bacterial proteasome activator
    Species: MYCOBACTERIUM TUBERCULOSIS H37RV [TaxId:83332]
    Gene: bpa, Rv3780, MTCY13D12.14
    Database cross-references and differences (RAF-indexed):
  • Chain 'M':
    Compound: Bacterial proteasome activator
    Species: MYCOBACTERIUM TUBERCULOSIS H37RV [TaxId:83332]
    Gene: bpa, Rv3780, MTCY13D12.14
    Database cross-references and differences (RAF-indexed):
  • Chain 'N':
    Compound: Bacterial proteasome activator
    Species: MYCOBACTERIUM TUBERCULOSIS H37RV [TaxId:83332]
    Gene: bpa, Rv3780, MTCY13D12.14
    Database cross-references and differences (RAF-indexed):
  • Chain 'O':
    Compound: Bacterial proteasome activator
    Species: MYCOBACTERIUM TUBERCULOSIS H37RV [TaxId:83332]
    Gene: bpa, Rv3780, MTCY13D12.14
    Database cross-references and differences (RAF-indexed):
  • Chain 'P':
    Compound: Bacterial proteasome activator
    Species: MYCOBACTERIUM TUBERCULOSIS H37RV [TaxId:83332]
    Gene: bpa, Rv3780, MTCY13D12.14
    Database cross-references and differences (RAF-indexed):

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >5lfqA (A:)
    mhhhhhhsltdlveqpakvmrigtmikqlleevraapldeasrnrlrdihatsireledg
    lapelreeldrltlpfnedavpsdaelriaqaqlvgwleglfhgiqtalfaqqmaaraql
    qqmrqgalppg
    

    Sequence, based on observed residues (ATOM records):
    >5lfqA (A:)
    ltdlveqpakvmrigtmikqlleevraapldeasrnrlrdihatsireledglapelree
    ldrltlpfnedavpsdaelriaqaqlvgwleglfhgiqtalfaqqmaaraqlq
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >5lfqB (B:)
    mhhhhhhsltdlveqpakvmrigtmikqlleevraapldeasrnrlrdihatsireledg
    lapelreeldrltlpfnedavpsdaelriaqaqlvgwleglfhgiqtalfaqqmaaraql
    qqmrqgalppg
    

    Sequence, based on observed residues (ATOM records):
    >5lfqB (B:)
    ltdlveqpakvmrigtmikqlleevraapldeasrnrlrdihatsireledglapelree
    ldrltlpfnedavpsdaelriaqaqlvgwleglfhgiqtalfaqqmaaraqlq
    

  • Chain 'C':
    Sequence, based on SEQRES records:
    >5lfqC (C:)
    mhhhhhhsltdlveqpakvmrigtmikqlleevraapldeasrnrlrdihatsireledg
    lapelreeldrltlpfnedavpsdaelriaqaqlvgwleglfhgiqtalfaqqmaaraql
    qqmrqgalppg
    

    Sequence, based on observed residues (ATOM records):
    >5lfqC (C:)
    ltdlveqpakvmrigtmikqlleevraapldeasrnrlrdihatsireledglapelree
    ldrltlpfnedavpsdaelriaqaqlvgwleglfhgiqtalfaqqmaaraqlq
    

  • Chain 'D':
    Sequence, based on SEQRES records:
    >5lfqD (D:)
    mhhhhhhsltdlveqpakvmrigtmikqlleevraapldeasrnrlrdihatsireledg
    lapelreeldrltlpfnedavpsdaelriaqaqlvgwleglfhgiqtalfaqqmaaraql
    qqmrqgalppg
    

    Sequence, based on observed residues (ATOM records):
    >5lfqD (D:)
    ltdlveqpakvmrigtmikqlleevraapldeasrnrlrdihatsireledglapelree
    ldrltlpfnedavpsdaelriaqaqlvgwleglfhgiqtalfaqqmaaraqlq
    

  • Chain 'E':
    Sequence, based on SEQRES records:
    >5lfqE (E:)
    mhhhhhhsltdlveqpakvmrigtmikqlleevraapldeasrnrlrdihatsireledg
    lapelreeldrltlpfnedavpsdaelriaqaqlvgwleglfhgiqtalfaqqmaaraql
    qqmrqgalppg
    

    Sequence, based on observed residues (ATOM records):
    >5lfqE (E:)
    ltdlveqpakvmrigtmikqlleevraapldeasrnrlrdihatsireledglapelree
    ldrltlpfnedavpsdaelriaqaqlvgwleglfhgiqtalfaqqmaaraqlq
    

  • Chain 'F':
    Sequence, based on SEQRES records:
    >5lfqF (F:)
    mhhhhhhsltdlveqpakvmrigtmikqlleevraapldeasrnrlrdihatsireledg
    lapelreeldrltlpfnedavpsdaelriaqaqlvgwleglfhgiqtalfaqqmaaraql
    qqmrqgalppg
    

    Sequence, based on observed residues (ATOM records):
    >5lfqF (F:)
    ltdlveqpakvmrigtmikqlleevraapldeasrnrlrdihatsireledglapelree
    ldrltlpfnedavpsdaelriaqaqlvgwleglfhgiqtalfaqqmaaraqlq
    

  • Chain 'G':
    Sequence, based on SEQRES records:
    >5lfqG (G:)
    mhhhhhhsltdlveqpakvmrigtmikqlleevraapldeasrnrlrdihatsireledg
    lapelreeldrltlpfnedavpsdaelriaqaqlvgwleglfhgiqtalfaqqmaaraql
    qqmrqgalppg
    

    Sequence, based on observed residues (ATOM records):
    >5lfqG (G:)
    ltdlveqpakvmrigtmikqlleevraapldeasrnrlrdihatsireledglapelree
    ldrltlpfnedavpsdaelriaqaqlvgwleglfhgiqtalfaqqmaaraqlq
    

  • Chain 'H':
    Sequence, based on SEQRES records:
    >5lfqH (H:)
    mhhhhhhsltdlveqpakvmrigtmikqlleevraapldeasrnrlrdihatsireledg
    lapelreeldrltlpfnedavpsdaelriaqaqlvgwleglfhgiqtalfaqqmaaraql
    qqmrqgalppg
    

    Sequence, based on observed residues (ATOM records):
    >5lfqH (H:)
    ltdlveqpakvmrigtmikqlleevraapldeasrnrlrdihatsireledglapelree
    ldrltlpfnedavpsdaelriaqaqlvgwleglfhgiqtalfaqqmaaraqlq
    

  • Chain 'I':
    Sequence, based on SEQRES records:
    >5lfqI (I:)
    mhhhhhhsltdlveqpakvmrigtmikqlleevraapldeasrnrlrdihatsireledg
    lapelreeldrltlpfnedavpsdaelriaqaqlvgwleglfhgiqtalfaqqmaaraql
    qqmrqgalppg
    

    Sequence, based on observed residues (ATOM records):
    >5lfqI (I:)
    ltdlveqpakvmrigtmikqlleevraapldeasrnrlrdihatsireledglapelree
    ldrltlpfnedavpsdaelriaqaqlvgwleglfhgiqtalfaqqmaaraqlq
    

  • Chain 'J':
    Sequence, based on SEQRES records:
    >5lfqJ (J:)
    mhhhhhhsltdlveqpakvmrigtmikqlleevraapldeasrnrlrdihatsireledg
    lapelreeldrltlpfnedavpsdaelriaqaqlvgwleglfhgiqtalfaqqmaaraql
    qqmrqgalppg
    

    Sequence, based on observed residues (ATOM records):
    >5lfqJ (J:)
    ltdlveqpakvmrigtmikqlleevraapldeasrnrlrdihatsireledglapelree
    ldrltlpfnedavpsdaelriaqaqlvgwleglfhgiqtalfaqqmaaraqlq
    

  • Chain 'K':
    Sequence, based on SEQRES records:
    >5lfqK (K:)
    mhhhhhhsltdlveqpakvmrigtmikqlleevraapldeasrnrlrdihatsireledg
    lapelreeldrltlpfnedavpsdaelriaqaqlvgwleglfhgiqtalfaqqmaaraql
    qqmrqgalppg
    

    Sequence, based on observed residues (ATOM records):
    >5lfqK (K:)
    ltdlveqpakvmrigtmikqlleevraapldeasrnrlrdihatsireledglapelree
    ldrltlpfnedavpsdaelriaqaqlvgwleglfhgiqtalfaqqmaaraqlq
    

  • Chain 'L':
    Sequence, based on SEQRES records:
    >5lfqL (L:)
    mhhhhhhsltdlveqpakvmrigtmikqlleevraapldeasrnrlrdihatsireledg
    lapelreeldrltlpfnedavpsdaelriaqaqlvgwleglfhgiqtalfaqqmaaraql
    qqmrqgalppg
    

    Sequence, based on observed residues (ATOM records):
    >5lfqL (L:)
    ltdlveqpakvmrigtmikqlleevraapldeasrnrlrdihatsireledglapelree
    ldrltlpfnedavpsdaelriaqaqlvgwleglfhgiqtalfaqqmaaraqlq
    

  • Chain 'M':
    Sequence, based on SEQRES records:
    >5lfqM (M:)
    mhhhhhhsltdlveqpakvmrigtmikqlleevraapldeasrnrlrdihatsireledg
    lapelreeldrltlpfnedavpsdaelriaqaqlvgwleglfhgiqtalfaqqmaaraql
    qqmrqgalppg
    

    Sequence, based on observed residues (ATOM records):
    >5lfqM (M:)
    ltdlveqpakvmrigtmikqlleevraapldeasrnrlrdihatsireledglapelree
    ldrltlpfnedavpsdaelriaqaqlvgwleglfhgiqtalfaqqmaaraqlq
    

  • Chain 'N':
    Sequence, based on SEQRES records:
    >5lfqN (N:)
    mhhhhhhsltdlveqpakvmrigtmikqlleevraapldeasrnrlrdihatsireledg
    lapelreeldrltlpfnedavpsdaelriaqaqlvgwleglfhgiqtalfaqqmaaraql
    qqmrqgalppg
    

    Sequence, based on observed residues (ATOM records):
    >5lfqN (N:)
    ltdlveqpakvmrigtmikqlleevraapldeasrnrlrdihatsireledglapelree
    ldrltlpfnedavpsdaelriaqaqlvgwleglfhgiqtalfaqqmaaraqlq
    

  • Chain 'O':
    Sequence, based on SEQRES records:
    >5lfqO (O:)
    mhhhhhhsltdlveqpakvmrigtmikqlleevraapldeasrnrlrdihatsireledg
    lapelreeldrltlpfnedavpsdaelriaqaqlvgwleglfhgiqtalfaqqmaaraql
    qqmrqgalppg
    

    Sequence, based on observed residues (ATOM records):
    >5lfqO (O:)
    ltdlveqpakvmrigtmikqlleevraapldeasrnrlrdihatsireledglapelree
    ldrltlpfnedavpsdaelriaqaqlvgwleglfhgiqtalfaqqmaaraqlq
    

  • Chain 'P':
    Sequence, based on SEQRES records:
    >5lfqP (P:)
    mhhhhhhsltdlveqpakvmrigtmikqlleevraapldeasrnrlrdihatsireledg
    lapelreeldrltlpfnedavpsdaelriaqaqlvgwleglfhgiqtalfaqqmaaraql
    qqmrqgalppg
    

    Sequence, based on observed residues (ATOM records):
    >5lfqP (P:)
    ltdlveqpakvmrigtmikqlleevraapldeasrnrlrdihatsireledglapelree
    ldrltlpfnedavpsdaelriaqaqlvgwleglfhgiqtalfaqqmaaraqlq