PDB entry 5lf6

View 5lf6 on RCSB PDB site
Description: human 20s proteasome complex with z-lly-ketoaldehyde at 2.1 angstrom
Deposited on 2016-06-30, released 2016-08-17
The last revision was dated 2017-09-06, with a file datestamp of 2017-09-01.
Experiment type: XRAY
Resolution: 2.07 Å
R-factor: N/A
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Proteasome subunit alpha type-2
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Proteasome subunit alpha type-4
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: Proteasome subunit alpha type-7
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: Proteasome subunit alpha type-5
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
  • Chain 'E':
    Compound: Proteasome subunit alpha type-1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P25786
      • modified residue (147)
  • Chain 'F':
    Compound: Proteasome subunit alpha type-3
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
  • Chain 'G':
    Compound: Proteasome subunit alpha type-6
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
  • Chain 'H':
    Compound: Proteasome subunit beta type-7
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
  • Chain 'I':
    Compound: Proteasome subunit beta type-3
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
  • Chain 'J':
    Compound: Proteasome subunit beta type-2
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
  • Chain 'K':
    Compound: Proteasome subunit beta type-5
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
  • Chain 'L':
    Compound: Proteasome subunit beta type-1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
  • Chain 'M':
    Compound: Proteasome subunit beta type-4
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
  • Chain 'N':
    Compound: Proteasome subunit beta type-6
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
  • Chain 'O':
    Compound: Proteasome subunit alpha type-2
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
  • Chain 'P':
    Compound: Proteasome subunit alpha type-4
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
  • Chain 'Q':
    Compound: Proteasome subunit alpha type-7
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
  • Chain 'R':
    Compound: Proteasome subunit alpha type-5
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
  • Chain 'S':
    Compound: Proteasome subunit alpha type-1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P25786
      • modified residue (147)
  • Chain 'T':
    Compound: Proteasome subunit alpha type-3
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
  • Chain 'U':
    Compound: Proteasome subunit alpha type-6
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
  • Chain 'V':
    Compound: Proteasome subunit beta type-7
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
  • Chain 'W':
    Compound: Proteasome subunit beta type-3
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
  • Chain 'X':
    Compound: Proteasome subunit beta type-2
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
  • Chain 'Y':
    Compound: Proteasome subunit beta type-5
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
  • Chain 'Z':
    Compound: Proteasome subunit beta type-1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
  • Chain 'a':
    Compound: Proteasome subunit beta type-4
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
  • Chain 'b':
    Compound: Proteasome subunit beta type-6
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
  • Chain 'c':
    Compound: LLY-ketoaldehyde peptide
    Species: HOMO SAPIENS, synthetic [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 5LF6 (0-2)
  • Chain 'd':
    Compound: LLY-ketoaldehyde peptide
    Species: HOMO SAPIENS, synthetic [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 5LF6 (0-2)
  • Heterogens: CL, K, MG, 1PE, PHQ, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >5lf6A (A:)
    maergysfslttfspsgklvqieyalaavaggapsvgikaangvvlatekkqksilyder
    svhkvepitkhiglvysgmgpdyrvlvhrarklaqqyylvyqepiptaqlvqrvasvmqe
    ytqsggvrpfgvsllicgwnegrpylfqsdpsgayfawkatamgknyvngktflekryne
    dleledaihtailtlkesfegqmtednievgicneagfrrltptevkdylaaia
    

    Sequence, based on observed residues (ATOM records):
    >5lf6A (A:)
    rgysfslttfspsgklvqieyalaavaggapsvgikaangvvlatekkqksilydersvh
    kvepitkhiglvysgmgpdyrvlvhrarklaqqyylvyqepiptaqlvqrvasvmqeytq
    sggvrpfgvsllicgwnegrpylfqsdpsgayfawkatamgknyvngktflekrynedle
    ledaihtailtlkesfegqmtednievgicneagfrrltptevkdylaai
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >5lf6B (B:)
    msrrydsrttifspegrlyqveyameaighagtclgilandgvllaaerrnihklldevf
    fsekiyklnedmacsvagitsdanvltnelrliaqryllqyqepipceqlvtalcdikqa
    ytqfggkrpfgvsllyigwdkhygfqlyqsdpsgnyggwkatcignnsaaavsmlkqdyk
    egemtlksalalaikvlnktmdvsklsaekveiatltrengktvirvlkqkeveqlikkh
    eeeeakaerekkekeqkekdk
    

    Sequence, based on observed residues (ATOM records):
    >5lf6B (B:)
    srrydsrttifspegrlyqveyameaighagtclgilandgvllaaerrnihklldevff
    sekiyklnedmacsvagitsdanvltnelrliaqryllqyqepipceqlvtalcdikqay
    tqfggkrpfgvsllyigwdkhygfqlyqsdpsgnyggwkatcignnsaaavsmlkqdyke
    gemtlksalalaikvlnktmdvsklsaekveiatltrengktvirvlkqkeveqlikkhe
    eeeakaer
    

  • Chain 'C':
    Sequence, based on SEQRES records:
    >5lf6C (C:)
    msydraitvfspdghlfqveyaqeavkkgstavgvrgrdivvlgvekksvaklqdertvr
    kicalddnvcmafagltadarivinrarvecqshrltvedpvtveyitryiaslkqrytq
    sngrrpfgisalivgfdfdgtprlyqtdpsgtyhawkanaigrgaksvrefleknytdea
    ietddltiklvikallevvqsggknielavmrrdqslkilnpeeiekyvaeiekekeene
    kkkqkkas
    

    Sequence, based on observed residues (ATOM records):
    >5lf6C (C:)
    sydraitvfspdghlfqveyaqeavkkgstavgvrgrdivvlgvekksvaklqdertvrk
    icalddnvcmafagltadarivinrarvecqshrltvedpvtveyitryiaslkqrytqs
    ngrrpfgisalivgfdfdgtprlyqtdpsgtyhawkanaigrgaksvrefleknytdeai
    etddltiklvikallevvqsggknielavmrrdqslkilnpeeiekyvaeiekekee
    

  • Chain 'D':
    Sequence, based on SEQRES records:
    >5lf6D (D:)
    mfltrseydrgvntfspegrlfqveyaieaiklgstaigiqtsegvclavekritsplme
    pssiekiveidahigcamsgliadaktlidkarvetqnhwftynetmtvesvtqavsnla
    lqfgeedadpgamsrpfgvallfggvdekgpqlfhmdpsgtfvqcdaraigsasegaqss
    lqevyhksmtlkeaikssliilkqvmeeklnatnielatvqpgqnfhmftkeeleevikd
    i
    

    Sequence, based on observed residues (ATOM records):
    >5lf6D (D:)
    drgvntfspegrlfqveyaieaiklgstaigiqtsegvclavekritsplmepssiekiv
    eidahigcamsgliadaktlidkarvetqnhwftynetmtvesvtqavsnlalqfgeeda
    dpgamsrpfgvallfggvdekgpqlfhmdpsgtfvqcdaraigsasegaqsslqevyhks
    mtlkeaikssliilkqvmeeklnatnielatvqpgqnfhmftkeeleevikdi
    

  • Chain 'E':
    Sequence, based on SEQRES records:
    >5lf6E (E:)
    mfrnqydndvtvwspqgrihqieyameavkqgsatvglkskthavlvalkraqselaahq
    kkilhvdnhigisiagltadarllcnfmrqecldsrfvfdrplpvsrlvsligsktqipt
    qrygrrpygvglliagyddmgphifqtxpsanyfdcramsigarsqsartylerhmsefm
    ecnlnelvkhglralretlpaeqdlttknvsigivgkdleftiyddddvspflegleerp
    qrkaqpaqpadepaekadepmeh
    

    Sequence, based on observed residues (ATOM records):
    >5lf6E (E:)
    nqydndvtvwspqgrihqieyameavkqgsatvglkskthavlvalkraqselaahqkki
    lhvdnhigisiagltadarllcnfmrqecldsrfvfdrplpvsrlvsligsktqiptqry
    grrpygvglliagyddmgphifqtxpsanyfdcramsigarsqsartylerhmsefmecn
    lnelvkhglralretlpaeqdlttknvsigivgkdleftiyddddvspflegle
    

  • Chain 'F':
    Sequence, based on SEQRES records:
    >5lf6F (F:)
    mssigtgydlsastfspdgrvfqveyamkavensstaigirckdgvvfgveklvlsklye
    egsnkrlfnvdrhvgmavaglladarsladiareeasnfrsnfgyniplkhladrvamyv
    haytlysavrpfgcsfmlgsysvndgaqlymidpsgvsygywgcaigkarqaakteiekl
    qmkemtcrdivkevakiiyivhdevkdkafelelswvgeltngrheivpkdireeaekya
    keslkeedesdddnm
    

    Sequence, based on observed residues (ATOM records):
    >5lf6F (F:)
    gydlsastfspdgrvfqveyamkavensstaigirckdgvvfgveklvlsklyeegsnkr
    lfnvdrhvgmavaglladarsladiareeasnfrsnfgyniplkhladrvamyvhaytly
    savrpfgcsfmlgsysvndgaqlymidpsgvsygywgcaigkarqaakteieklqmkemt
    crdivkevakiiyivhdevkdkafelelswvgeltngrheivpkdireeaekyakeslk
    

  • Chain 'G':
    Sequence, based on SEQRES records:
    >5lf6G (G:)
    msrgssagfdrhitifspegrlyqveyafkainqggltsvavrgkdxavivtqkkvpdkl
    ldsstvthlfkitenigcvmtgmtadsrsqvqraryeaanwkykygyeipvdmlckriad
    isqvytqnaemrplgccmiligideeqgpqvykcdpagyyxgfkataagvkqtestsfle
    kkvkkkfdwtfeqtvetaitclstvlsidfkpseievgvvtvenpkfrilteaeidahlv
    alaerd
    

    Sequence, based on observed residues (ATOM records):
    >5lf6G (G:)
    srgssagfdrhitifspegrlyqveyafkainqggltsvavrgkdxavivtqkkvpdkll
    dsstvthlfkitenigcvmtgmtadsrsqvqraryeaanwkykygyeipvdmlckriadi
    sqvytqnaemrplgccmiligideeqgpqvykcdpagyyxgfkataagvkqtestsflek
    kvkkkfdwtfeqtvetaitclstvlsidfkpseievgvvtvenpkfrilteaeidahlva
    laer
    

  • Chain 'H':
    Sequence, based on SEQRES records:
    >5lf6H (H:)
    ttiagvvykdgivlgadtrategmvvadkncskihfispniyccgagtaadtdmttqlis
    snlelhslstgrlprvvtanrmlkqmlfryqgyigaalvlggvdvtgphlysiyphgstd
    klpyvtmgsgslaamavfedkfrpdmeeeeaknlvseaiaagifndlgsgsnidlcvisk
    nkldflrpytvpnkkgtrlgryrcekgttavltekitpleievleetvqtmdts
    

    Sequence, based on observed residues (ATOM records):
    >5lf6H (H:)
    ttiagvvykdgivlgadtrategmvvadkncskihfispniyccgagtaadtdmttqlis
    snlelhslstgrlprvvtanrmlkqmlfryqgyigaalvlggvdvtgphlysiyphgstd
    klpyvtmgsgslaamavfedkfrpdmeeeeaknlvseaiaagifndlgsgsnidlcvisk
    nkldflrpytvpnkkgtrlgryrcekgttavltekitple
    

  • Chain 'I':
    Sequence, based on SEQRES records:
    >5lf6I (I:)
    msimsynggavmamkgkncvaiaadrrfgiqaqmvttdfqkifpmgdrlyiglaglatdv
    qtvaqrlkfrlnlyelkegrqikpytlmsmvanllyekrfgpyytepviagldpktfkpf
    icsldligcpmvtddfvvsgtcaeqmygmceslwepnmdpdhlfetisqamlnavdrdav
    sgmgvivhiiekdkittrtlkarmd
    

    Sequence, based on observed residues (ATOM records):
    >5lf6I (I:)
    simsynggavmamkgkncvaiaadrrfgiqaqmvttdfqkifpmgdrlyiglaglatdvq
    tvaqrlkfrlnlyelkegrqikpytlmsmvanllyekrfgpyytepviagldpktfkpfi
    csldligcpmvtddfvvsgtcaeqmygmceslwepnmdpdhlfetisqamlnavdrdavs
    gmgvivhiiekdkittrtlkarmd
    

  • Chain 'J':
    Sequence, based on SEQRES records:
    >5lf6J (J:)
    meyligiqgpdyvlvasdrvaasnivqmkddhdkmfkmsekilllcvgeagdtvqfaeyi
    qknvqlykmrngyelsptaaanftrrnladxlrsrtpyhvnlllagydehegpalyymdy
    laalakapfaahgygafltlsildryytptisreravellrkcleelqkrfilnlptfsv
    riidkngihdldnisfpkqgs
    

    Sequence, based on observed residues (ATOM records):
    >5lf6J (J:)
    meyligiqgpdyvlvasdrvaasnivqmkddhdkmfkmsekilllcvgeagdtvqfaeyi
    qknvqlykmrngyelsptaaanftrrnladxlrsrtpyhvnlllagydehegpalyymdy
    laalakapfaahgygafltlsildryytptisreravellrkcleelqkrfilnlptfsv
    riidkngihdldnisf
    

  • Chain 'K':
    Sequence, based on SEQRES records:
    >5lf6K (K:)
    tttlafkfrhgvivaadsratagayiasqtvkkvieinpyllgtmaggaadcsfwerlla
    rqcriyelrnkerisvaaaskllanmvyqykgmglsmgtmicgwdkrgpglyyvdsegnr
    isgatfsvgsgsvyaygvmdrgysydleveqaydlarraiyqatyrdaysggavnlyhvr
    edgwirvssdnvadlhekysgstp
    

    Sequence, based on observed residues (ATOM records):
    >5lf6K (K:)
    tttlafkfrhgvivaadsratagayiasqtvkkvieinpyllgtmaggaadcsfwerlla
    rqcriyelrnkerisvaaaskllanmvyqykgmglsmgtmicgwdkrgpglyyvdsegnr
    isgatfsvgsgsvyaygvmdrgysydleveqaydlarraiyqatyrdaysggavnlyhvr
    edgwirvssdnvadlhekys
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records:
    >5lf6L (L:)
    rfspyvfnggtilaiagedfaivasdtrlsegfsihtrdspkcykltdktvigcsgfhgd
    cltltkiiearlkmykhsnnkamttgaiaamlstilysrrffpyyvyniiggldeegkga
    vysfdpvgsyqrdsfkaggsasamlqplldnqvgfknmqnvehvplsldramrlvkdvfi
    saaerdvytgdalricivtkegireetvslrkd
    

  • Chain 'M':
    Sequence, based on SEQRES records:
    >5lf6M (M:)
    tqnpmvtgtsvlgvkfeggvviaadmlgsygslarfrnisrimrvnnstmlgasgdyadf
    qylkqvlgqmvideellgdghsyspraihswltramysrrskmnplwntmviggyadges
    flgyvdmlgvayeapslatgygaylaqpllrevlekqpvlsqteardlvercmrvlyyrd
    arsynrfqiatvtekgveiegplstetnwdiahmisgfe
    

    Sequence, based on observed residues (ATOM records):
    >5lf6M (M:)
    tqnpmvtgtsvlgvkfeggvviaadmlgsygslarfrnisrimrvnnstmlgasgdyadf
    qylkqvlgqmvideellgdghsyspraihswltramysrrskmnplwntmviggyadges
    flgyvdmlgvayeapslatgygaylaqpllrevlekqpvlsqteardlvercmrvlyyrd
    arsynrfqiatvtekgveiegplstetnwdiahmis
    

  • Chain 'N':
    Sequence, based on SEQRES records:
    >5lf6N (N:)
    ttimavqfdggvvlgadsrtttgsyianrvtdkltpihdrifccrsgsaadtqavadavt
    yqlgfhsielnepplvhtaaslfkemcyryredlmagiiiagwdpqeggqvysvpmggmm
    vrqsfaiggsgssyiygyvdatyregmtkeeclqftanalalamerdgssggvirlaaia
    esgverqvllgdqipkfavatlppa
    

    Sequence, based on observed residues (ATOM records):
    >5lf6N (N:)
    ttimavqfdggvvlgadsrtttgsyianrvtdkltpihdrifccrsgsaadtqavadavt
    yqlgfhsielnepplvhtaaslfkemcyryredlmagiiiagwdpqeggqvysvpmggmm
    vrqsfaiggsgssyiygyvdatyregmtkeeclqftanalalamerdgssggvirlaaia
    esgverqvllgdqipkfavatl
    

  • Chain 'O':
    Sequence, based on SEQRES records:
    >5lf6O (O:)
    maergysfslttfspsgklvqieyalaavaggapsvgikaangvvlatekkqksilyder
    svhkvepitkhiglvysgmgpdyrvlvhrarklaqqyylvyqepiptaqlvqrvasvmqe
    ytqsggvrpfgvsllicgwnegrpylfqsdpsgayfawkatamgknyvngktflekryne
    dleledaihtailtlkesfegqmtednievgicneagfrrltptevkdylaaia
    

    Sequence, based on observed residues (ATOM records):
    >5lf6O (O:)
    rgysfslttfspsgklvqieyalaavaggapsvgikaangvvlatekkqksilydersvh
    kvepitkhiglvysgmgpdyrvlvhrarklaqqyylvyqepiptaqlvqrvasvmqeytq
    sggvrpfgvsllicgwnegrpylfqsdpsgayfawkatamgknyvngktflekrynedle
    ledaihtailtlkesfegqmtednievgicneagfrrltptevkdylaai
    

  • Chain 'P':
    Sequence, based on SEQRES records:
    >5lf6P (P:)
    msrrydsrttifspegrlyqveyameaighagtclgilandgvllaaerrnihklldevf
    fsekiyklnedmacsvagitsdanvltnelrliaqryllqyqepipceqlvtalcdikqa
    ytqfggkrpfgvsllyigwdkhygfqlyqsdpsgnyggwkatcignnsaaavsmlkqdyk
    egemtlksalalaikvlnktmdvsklsaekveiatltrengktvirvlkqkeveqlikkh
    eeeeakaerekkekeqkekdk
    

    Sequence, based on observed residues (ATOM records):
    >5lf6P (P:)
    srrydsrttifspegrlyqveyameaighagtclgilandgvllaaerrnihklldevff
    sekiyklnedmacsvagitsdanvltnelrliaqryllqyqepipceqlvtalcdikqay
    tqfggkrpfgvsllyigwdkhygfqlyqsdpsgnyggwkatcignnsaaavsmlkqdyke
    gemtlksalalaikvlnktmdvsklsaekveiatltrengktvirvlkqkeveqlikkhe
    eeeakaer
    

  • Chain 'Q':
    Sequence, based on SEQRES records:
    >5lf6Q (Q:)
    msydraitvfspdghlfqveyaqeavkkgstavgvrgrdivvlgvekksvaklqdertvr
    kicalddnvcmafagltadarivinrarvecqshrltvedpvtveyitryiaslkqrytq
    sngrrpfgisalivgfdfdgtprlyqtdpsgtyhawkanaigrgaksvrefleknytdea
    ietddltiklvikallevvqsggknielavmrrdqslkilnpeeiekyvaeiekekeene
    kkkqkkas
    

    Sequence, based on observed residues (ATOM records):
    >5lf6Q (Q:)
    sydraitvfspdghlfqveyaqeavkkgstavgvrgrdivvlgvekksvaklqdertvrk
    icalddnvcmafagltadarivinrarvecqshrltvedpvtveyitryiaslkqrytqs
    ngrrpfgisalivgfdfdgtprlyqtdpsgtyhawkanaigrgaksvrefleknytdeai
    etddltiklvikallevvqsggknielavmrrdqslkilnpeeiekyvaeiekekeene
    

  • Chain 'R':
    Sequence, based on SEQRES records:
    >5lf6R (R:)
    mfltrseydrgvntfspegrlfqveyaieaiklgstaigiqtsegvclavekritsplme
    pssiekiveidahigcamsgliadaktlidkarvetqnhwftynetmtvesvtqavsnla
    lqfgeedadpgamsrpfgvallfggvdekgpqlfhmdpsgtfvqcdaraigsasegaqss
    lqevyhksmtlkeaikssliilkqvmeeklnatnielatvqpgqnfhmftkeeleevikd
    i
    

    Sequence, based on observed residues (ATOM records):
    >5lf6R (R:)
    drgvntfspegrlfqveyaieaiklgstaigiqtsegvclavekritsplmepssiekiv
    eidahigcamsgliadaktlidkarvetqnhwftynetmtvesvtqavsnlalqfgeeda
    dpgamsrpfgvallfggvdekgpqlfhmdpsgtfvqcdaraigsasegaqsslqevyhks
    mtlkeaikssliilkqvmeeklnatnielatvqpgqnfhmftkeeleevikdi
    

  • Chain 'S':
    Sequence, based on SEQRES records:
    >5lf6S (S:)
    mfrnqydndvtvwspqgrihqieyameavkqgsatvglkskthavlvalkraqselaahq
    kkilhvdnhigisiagltadarllcnfmrqecldsrfvfdrplpvsrlvsligsktqipt
    qrygrrpygvglliagyddmgphifqtxpsanyfdcramsigarsqsartylerhmsefm
    ecnlnelvkhglralretlpaeqdlttknvsigivgkdleftiyddddvspflegleerp
    qrkaqpaqpadepaekadepmeh
    

    Sequence, based on observed residues (ATOM records):
    >5lf6S (S:)
    frnqydndvtvwspqgrihqieyameavkqgsatvglkskthavlvalkraqselaahqk
    kilhvdnhigisiagltadarllcnfmrqecldsrfvfdrplpvsrlvsligsktqiptq
    rygrrpygvglliagyddmgphifqtxpsanyfdcramsigarsqsartylerhmsefme
    cnlnelvkhglralretlpaeqdlttknvsigivgkdleftiyddddvspflegleer
    

  • Chain 'T':
    Sequence, based on SEQRES records:
    >5lf6T (T:)
    mssigtgydlsastfspdgrvfqveyamkavensstaigirckdgvvfgveklvlsklye
    egsnkrlfnvdrhvgmavaglladarsladiareeasnfrsnfgyniplkhladrvamyv
    haytlysavrpfgcsfmlgsysvndgaqlymidpsgvsygywgcaigkarqaakteiekl
    qmkemtcrdivkevakiiyivhdevkdkafelelswvgeltngrheivpkdireeaekya
    keslkeedesdddnm
    

    Sequence, based on observed residues (ATOM records):
    >5lf6T (T:)
    tgydlsastfspdgrvfqveyamkavensstaigirckdgvvfgveklvlsklyeegsnk
    rlfnvdrhvgmavaglladarsladiareeasnfrsnfgyniplkhladrvamyvhaytl
    ysavrpfgcsfmlgsysvndgaqlymidpsgvsygywgcaigkarqaakteieklqmkem
    tcrdivkevakiiyivhdevkdkafelelswvgeltngrheivpkdireeaekyakeslk
    

  • Chain 'U':
    Sequence, based on SEQRES records:
    >5lf6U (U:)
    msrgssagfdrhitifspegrlyqveyafkainqggltsvavrgkdxavivtqkkvpdkl
    ldsstvthlfkitenigcvmtgmtadsrsqvqraryeaanwkykygyeipvdmlckriad
    isqvytqnaemrplgccmiligideeqgpqvykcdpagyyxgfkataagvkqtestsfle
    kkvkkkfdwtfeqtvetaitclstvlsidfkpseievgvvtvenpkfrilteaeidahlv
    alaerd
    

    Sequence, based on observed residues (ATOM records):
    >5lf6U (U:)
    srgssagfdrhitifspegrlyqveyafkainqggltsvavrgkdxavivtqkkvpdkll
    dsstvthlfkitenigcvmtgmtadsrsqvqraryeaanwkykygyeipvdmlckriadi
    sqvytqnaemrplgccmiligideeqgpqvykcdpagyyxgfkataagvkqtestsflek
    kvkkkqtvetaitclstvlsidfkpseievgvvtvenpkfrilteaeidahlvalaer
    

  • Chain 'V':
    Sequence, based on SEQRES records:
    >5lf6V (V:)
    ttiagvvykdgivlgadtrategmvvadkncskihfispniyccgagtaadtdmttqlis
    snlelhslstgrlprvvtanrmlkqmlfryqgyigaalvlggvdvtgphlysiyphgstd
    klpyvtmgsgslaamavfedkfrpdmeeeeaknlvseaiaagifndlgsgsnidlcvisk
    nkldflrpytvpnkkgtrlgryrcekgttavltekitpleievleetvqtmdts
    

    Sequence, based on observed residues (ATOM records):
    >5lf6V (V:)
    ttiagvvykdgivlgadtrategmvvadkncskihfispniyccgagtaadtdmttqlis
    snlelhslstgrlprvvtanrmlkqmlfryqgyigaalvlggvdvtgphlysiyphgstd
    klpyvtmgsgslaamavfedkfrpdmeeeeaknlvseaiaagifndlgsgsnidlcvisk
    nkldflrpytvpnkkgtrlgryrcekgttavltekitple
    

  • Chain 'W':
    Sequence, based on SEQRES records:
    >5lf6W (W:)
    msimsynggavmamkgkncvaiaadrrfgiqaqmvttdfqkifpmgdrlyiglaglatdv
    qtvaqrlkfrlnlyelkegrqikpytlmsmvanllyekrfgpyytepviagldpktfkpf
    icsldligcpmvtddfvvsgtcaeqmygmceslwepnmdpdhlfetisqamlnavdrdav
    sgmgvivhiiekdkittrtlkarmd
    

    Sequence, based on observed residues (ATOM records):
    >5lf6W (W:)
    simsynggavmamkgkncvaiaadrrfgiqaqmvttdfqkifpmgdrlyiglaglatdvq
    tvaqrlkfrlnlyelkegrqikpytlmsmvanllyekrfgpyytepviagldpktfkpfi
    csldligcpmvtddfvvsgtcaeqmygmceslwepnmdpdhlfetisqamlnavdrdavs
    gmgvivhiiekdkittrtlkarmd
    

  • Chain 'X':
    Sequence, based on SEQRES records:
    >5lf6X (X:)
    meyligiqgpdyvlvasdrvaasnivqmkddhdkmfkmsekilllcvgeagdtvqfaeyi
    qknvqlykmrngyelsptaaanftrrnladxlrsrtpyhvnlllagydehegpalyymdy
    laalakapfaahgygafltlsildryytptisreravellrkcleelqkrfilnlptfsv
    riidkngihdldnisfpkqgs
    

    Sequence, based on observed residues (ATOM records):
    >5lf6X (X:)
    meyligiqgpdyvlvasdrvaasnivqmkddhdkmfkmsekilllcvgeagdtvqfaeyi
    qknvqlykmrngyelsptaaanftrrnladxlrsrtpyhvnlllagydehegpalyymdy
    laalakapfaahgygafltlsildryytptisreravellrkcleelqkrfilnlptfsv
    riidkngihdldnisf
    

  • Chain 'Y':
    Sequence, based on SEQRES records:
    >5lf6Y (Y:)
    tttlafkfrhgvivaadsratagayiasqtvkkvieinpyllgtmaggaadcsfwerlla
    rqcriyelrnkerisvaaaskllanmvyqykgmglsmgtmicgwdkrgpglyyvdsegnr
    isgatfsvgsgsvyaygvmdrgysydleveqaydlarraiyqatyrdaysggavnlyhvr
    edgwirvssdnvadlhekysgstp
    

    Sequence, based on observed residues (ATOM records):
    >5lf6Y (Y:)
    tttlafkfrhgvivaadsratagayiasqtvkkvieinpyllgtmaggaadcsfwerlla
    rqcriyelrnkerisvaaaskllanmvyqykgmglsmgtmicgwdkrgpglyyvdsegnr
    isgatfsvgsgsvyaygvmdrgysydleveqaydlarraiyqatyrdaysggavnlyhvr
    edgwirvssdnvadlhekysg
    

  • Chain 'Z':
    Sequence; same for both SEQRES and ATOM records:
    >5lf6Z (Z:)
    rfspyvfnggtilaiagedfaivasdtrlsegfsihtrdspkcykltdktvigcsgfhgd
    cltltkiiearlkmykhsnnkamttgaiaamlstilysrrffpyyvyniiggldeegkga
    vysfdpvgsyqrdsfkaggsasamlqplldnqvgfknmqnvehvplsldramrlvkdvfi
    saaerdvytgdalricivtkegireetvslrkd
    

  • Chain 'a':
    Sequence, based on SEQRES records:
    >5lf6a (a:)
    tqnpmvtgtsvlgvkfeggvviaadmlgsygslarfrnisrimrvnnstmlgasgdyadf
    qylkqvlgqmvideellgdghsyspraihswltramysrrskmnplwntmviggyadges
    flgyvdmlgvayeapslatgygaylaqpllrevlekqpvlsqteardlvercmrvlyyrd
    arsynrfqiatvtekgveiegplstetnwdiahmisgfe
    

    Sequence, based on observed residues (ATOM records):
    >5lf6a (a:)
    tqnpmvtgtsvlgvkfeggvviaadmlgsygslarfrnisrimrvnnstmlgasgdyadf
    qylkqvlgqmvideellgdghsyspraihswltramysrrskmnplwntmviggyadges
    flgyvdmlgvayeapslatgygaylaqpllrevlekqpvlsqteardlvercmrvlyyrd
    arsynrfqiatvtekgveiegplstetnwdiahmis
    

  • Chain 'b':
    Sequence, based on SEQRES records:
    >5lf6b (b:)
    ttimavqfdggvvlgadsrtttgsyianrvtdkltpihdrifccrsgsaadtqavadavt
    yqlgfhsielnepplvhtaaslfkemcyryredlmagiiiagwdpqeggqvysvpmggmm
    vrqsfaiggsgssyiygyvdatyregmtkeeclqftanalalamerdgssggvirlaaia
    esgverqvllgdqipkfavatlppa
    

    Sequence, based on observed residues (ATOM records):
    >5lf6b (b:)
    ttimavqfdggvvlgadsrtttgsyianrvtdkltpihdrifccrsgsaadtqavadavt
    yqlgfhsielnepplvhtaaslfkemcyryredlmagiiiagwdpqeggqvysvpmggmm
    vrqsfaiggsgssyiygyvdatyregmtkeeclqftanalalamerdgssggvirlaaia
    esgverqvllgdqipkfavatlp
    

  • Chain 'c':
    Sequence; same for both SEQRES and ATOM records:
    >5lf6c (c:)
    llx
    

  • Chain 'd':
    Sequence; same for both SEQRES and ATOM records:
    >5lf6d (d:)
    llx