PDB entry 5lf4

View 5lf4 on RCSB PDB site
Description: Human 20S proteasome complex with Delanzomib at 2.0 Angstrom
Class: hydrolase
Keywords: Proteasome, Multicatalytic Proteinase, NTN-Hydrolase, Hydrolase
Deposited on 2016-06-30, released 2016-08-17
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-09-06, with a file datestamp of 2017-09-01.
Experiment type: XRAY
Resolution: 1.99 Å
R-factor: N/A
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Proteasome subunit alpha type-2
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5lf4a_
  • Chain 'B':
    Compound: Proteasome subunit alpha type-4
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5lf4b_
  • Chain 'C':
    Compound: Proteasome subunit alpha type-7
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5lf4c_
  • Chain 'D':
    Compound: Proteasome subunit alpha type-5
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5lf4d_
  • Chain 'E':
    Compound: Proteasome subunit alpha type-1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5lf4e_
  • Chain 'F':
    Compound: Proteasome subunit alpha type-3
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5lf4f_
  • Chain 'G':
    Compound: Proteasome subunit alpha type-6
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5lf4g_
  • Chain 'H':
    Compound: Proteasome subunit beta type-7
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5lf4h_
  • Chain 'I':
    Compound: Proteasome subunit beta type-3
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5lf4i_
  • Chain 'J':
    Compound: Proteasome subunit beta type-2
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5lf4j_
  • Chain 'K':
    Compound: Proteasome subunit beta type-5
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5lf4k_
  • Chain 'L':
    Compound: Proteasome subunit beta type-1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5lf4l_
  • Chain 'M':
    Compound: Proteasome subunit beta type-4
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5lf4m_
  • Chain 'N':
    Compound: Proteasome subunit beta type-6
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5lf4n_
  • Chain 'O':
    Compound: Proteasome subunit alpha type-2
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5lf4o_
  • Chain 'P':
    Compound: Proteasome subunit alpha type-4
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5lf4p_
  • Chain 'Q':
    Compound: Proteasome subunit alpha type-7
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5lf4q_
  • Chain 'R':
    Compound: Proteasome subunit alpha type-5
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5lf4r_
  • Chain 'S':
    Compound: Proteasome subunit alpha type-1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5lf4s_
  • Chain 'T':
    Compound: Proteasome subunit alpha type-3
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5lf4t_
  • Chain 'U':
    Compound: Proteasome subunit alpha type-6
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5lf4u_
  • Chain 'V':
    Compound: Proteasome subunit beta type-7
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5lf4v_
  • Chain 'W':
    Compound: Proteasome subunit beta type-3
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5lf4w_
  • Chain 'X':
    Compound: Proteasome subunit beta type-2
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5lf4x_
  • Chain 'Y':
    Compound: Proteasome subunit beta type-5
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5lf4y_
  • Chain 'Z':
    Compound: Proteasome subunit beta type-1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5lf4z_
  • Chain 'a':
    Compound: Proteasome subunit beta type-4
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
  • Chain 'b':
    Compound: Proteasome subunit beta type-6
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
  • Heterogens: CL, K, MG, 1PE, 6V7, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5lf4A (A:)
    maergysfslttfspsgklvqieyalaavaggapsvgikaangvvlatekkqksilyder
    svhkvepitkhiglvysgmgpdyrvlvhrarklaqqyylvyqepiptaqlvqrvasvmqe
    ytqsggvrpfgvsllicgwnegrpylfqsdpsgayfawkatamgknyvngktflekryne
    dleledaihtailtlkesfegqmtednievgicneagfrrltptevkdylaaia
    

    Sequence, based on observed residues (ATOM records): (download)
    >5lf4A (A:)
    rgysfslttfspsgklvqieyalaavaggapsvgikaangvvlatekkqksilydersvh
    kvepitkhiglvysgmgpdyrvlvhrarklaqqyylvyqepiptaqlvqrvasvmqeytq
    sggvrpfgvsllicgwnegrpylfqsdpsgayfawkatamgknyvngktflekrynedle
    ledaihtailtlkesfegqmtednievgicneagfrrltptevkdylaai
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5lf4B (B:)
    msrrydsrttifspegrlyqveyameaighagtclgilandgvllaaerrnihklldevf
    fsekiyklnedmacsvagitsdanvltnelrliaqryllqyqepipceqlvtalcdikqa
    ytqfggkrpfgvsllyigwdkhygfqlyqsdpsgnyggwkatcignnsaaavsmlkqdyk
    egemtlksalalaikvlnktmdvsklsaekveiatltrengktvirvlkqkeveqlikkh
    eeeeakaerekkekeqkekdk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5lf4B (B:)
    srrydsrttifspegrlyqveyameaighagtclgilandgvllaaerrnihklldevff
    sekiyklnedmacsvagitsdanvltnelrliaqryllqyqepipceqlvtalcdikqay
    tqfggkrpfgvsllyigwdkhygfqlyqsdpsgnyggwkatcignnsaaavsmlkqdyke
    gemtlksalalaikvlnktmdvsklsaekveiatltrengktvirvlkqkeveqlikkhe
    eeeakaer
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5lf4C (C:)
    msydraitvfspdghlfqveyaqeavkkgstavgvrgrdivvlgvekksvaklqdertvr
    kicalddnvcmafagltadarivinrarvecqshrltvedpvtveyitryiaslkqrytq
    sngrrpfgisalivgfdfdgtprlyqtdpsgtyhawkanaigrgaksvrefleknytdea
    ietddltiklvikallevvqsggknielavmrrdqslkilnpeeiekyvaeiekekeene
    kkkqkkas
    

    Sequence, based on observed residues (ATOM records): (download)
    >5lf4C (C:)
    sydraitvfspdghlfqveyaqeavkkgstavgvrgrdivvlgvekksvaklqdertvrk
    icalddnvcmafagltadarivinrarvecqshrltvedpvtveyitryiaslkqrytqs
    ngrrpfgisalivgfdfdgtprlyqtdpsgtyhawkanaigrgaksvrefleknytdeai
    etddltiklvikallevvqsggknielavmrrdqslkilnpeeiekyvaeiekekee
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5lf4D (D:)
    mfltrseydrgvntfspegrlfqveyaieaiklgstaigiqtsegvclavekritsplme
    pssiekiveidahigcamsgliadaktlidkarvetqnhwftynetmtvesvtqavsnla
    lqfgeedadpgamsrpfgvallfggvdekgpqlfhmdpsgtfvqcdaraigsasegaqss
    lqevyhksmtlkeaikssliilkqvmeeklnatnielatvqpgqnfhmftkeeleevikd
    i
    

    Sequence, based on observed residues (ATOM records): (download)
    >5lf4D (D:)
    drgvntfspegrlfqveyaieaiklgstaigiqtsegvclavekritsplmepssiekiv
    eidahigcamsgliadaktlidkarvetqnhwftynetmtvesvtqavsnlalqfgeeda
    dpgamsrpfgvallfggvdekgpqlfhmdpsgtfvqcdaraigsasegaqsslqevyhks
    mtlkeaikssliilkqvmeeklnatnielatvqpgqnfhmftkeeleevikdi
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >5lf4E (E:)
    mfrnqydndvtvwspqgrihqieyameavkqgsatvglkskthavlvalkraqselaahq
    kkilhvdnhigisiagltadarllcnfmrqecldsrfvfdrplpvsrlvsligsktqipt
    qrygrrpygvglliagyddmgphifqtxpsanyfdcramsigarsqsartylerhmsefm
    ecnlnelvkhglralretlpaeqdlttknvsigivgkdleftiyddddvspflegleerp
    qrkaqpaqpadepaekadepmeh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5lf4E (E:)
    nqydndvtvwspqgrihqieyameavkqgsatvglkskthavlvalkraqselaahqkki
    lhvdnhigisiagltadarllcnfmrqecldsrfvfdrplpvsrlvsligsktqiptqry
    grrpygvglliagyddmgphifqtxpsanyfdcramsigarsqsartylerhmsefmecn
    lnelvkhglralretlpaeqdlttknvsigivgkdleftiyddddvspflegle
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >5lf4F (F:)
    mssigtgydlsastfspdgrvfqveyamkavensstaigirckdgvvfgveklvlsklye
    egsnkrlfnvdrhvgmavaglladarsladiareeasnfrsnfgyniplkhladrvamyv
    haytlysavrpfgcsfmlgsysvndgaqlymidpsgvsygywgcaigkarqaakteiekl
    qmkemtcrdivkevakiiyivhdevkdkafelelswvgeltngrheivpkdireeaekya
    keslkeedesdddnm
    

    Sequence, based on observed residues (ATOM records): (download)
    >5lf4F (F:)
    gydlsastfspdgrvfqveyamkavensstaigirckdgvvfgveklvlsklyeegsnkr
    lfnvdrhvgmavaglladarsladiareeasnfrsnfgyniplkhladrvamyvhaytly
    savrpfgcsfmlgsysvndgaqlymidpsgvsygywgcaigkarqaakteieklqmkemt
    crdivkevakiiyivhdevkdkafelelswvgeltngrheivpkdireeaekyakeslk
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >5lf4G (G:)
    msrgssagfdrhitifspegrlyqveyafkainqggltsvavrgkdxavivtqkkvpdkl
    ldsstvthlfkitenigcvmtgmtadsrsqvqraryeaanwkykygyeipvdmlckriad
    isqvytqnaemrplgccmiligideeqgpqvykcdpagyyxgfkataagvkqtestsfle
    kkvkkkfdwtfeqtvetaitclstvlsidfkpseievgvvtvenpkfrilteaeidahlv
    alaerd
    

    Sequence, based on observed residues (ATOM records): (download)
    >5lf4G (G:)
    srgssagfdrhitifspegrlyqveyafkainqggltsvavrgkdxavivtqkkvpdkll
    dsstvthlfkitenigcvmtgmtadsrsqvqraryeaanwkykygyeipvdmlckriadi
    sqvytqnaemrplgccmiligideeqgpqvykcdpagyyxgfkataagvkqtestsflek
    kvkkkfdwtfeqtvetaitclstvlsidfkpseievgvvtvenpkfrilteaeidahlva
    laer
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >5lf4H (H:)
    ttiagvvykdgivlgadtrategmvvadkncskihfispniyccgagtaadtdmttqlis
    snlelhslstgrlprvvtanrmlkqmlfryqgyigaalvlggvdvtgphlysiyphgstd
    klpyvtmgsgslaamavfedkfrpdmeeeeaknlvseaiaagifndlgsgsnidlcvisk
    nkldflrpytvpnkkgtrlgryrcekgttavltekitpleievleetvqtmdts
    

    Sequence, based on observed residues (ATOM records): (download)
    >5lf4H (H:)
    ttiagvvykdgivlgadtrategmvvadkncskihfispniyccgagtaadtdmttqlis
    snlelhslstgrlprvvtanrmlkqmlfryqgyigaalvlggvdvtgphlysiyphgstd
    klpyvtmgsgslaamavfedkfrpdmeeeeaknlvseaiaagifndlgsgsnidlcvisk
    nkldflrpytvpnkkgtrlgryrcekgttavltekitple
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >5lf4I (I:)
    msimsynggavmamkgkncvaiaadrrfgiqaqmvttdfqkifpmgdrlyiglaglatdv
    qtvaqrlkfrlnlyelkegrqikpytlmsmvanllyekrfgpyytepviagldpktfkpf
    icsldligcpmvtddfvvsgtcaeqmygmceslwepnmdpdhlfetisqamlnavdrdav
    sgmgvivhiiekdkittrtlkarmd
    

    Sequence, based on observed residues (ATOM records): (download)
    >5lf4I (I:)
    simsynggavmamkgkncvaiaadrrfgiqaqmvttdfqkifpmgdrlyiglaglatdvq
    tvaqrlkfrlnlyelkegrqikpytlmsmvanllyekrfgpyytepviagldpktfkpfi
    csldligcpmvtddfvvsgtcaeqmygmceslwepnmdpdhlfetisqamlnavdrdavs
    gmgvivhiiekdkittrtlkarmd
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >5lf4J (J:)
    meyligiqgpdyvlvasdrvaasnivqmkddhdkmfkmsekilllcvgeagdtvqfaeyi
    qknvqlykmrngyelsptaaanftrrnladxlrsrtpyhvnlllagydehegpalyymdy
    laalakapfaahgygafltlsildryytptisreravellrkcleelqkrfilnlptfsv
    riidkngihdldnisfpkqgs
    

    Sequence, based on observed residues (ATOM records): (download)
    >5lf4J (J:)
    meyligiqgpdyvlvasdrvaasnivqmkddhdkmfkmsekilllcvgeagdtvqfaeyi
    qknvqlykmrngyelsptaaanftrrnladxlrsrtpyhvnlllagydehegpalyymdy
    laalakapfaahgygafltlsildryytptisreravellrkcleelqkrfilnlptfsv
    riidkngihdldnisf
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >5lf4K (K:)
    tttlafkfrhgvivaadsratagayiasqtvkkvieinpyllgtmaggaadcsfwerlla
    rqcriyelrnkerisvaaaskllanmvyqykgmglsmgtmicgwdkrgpglyyvdsegnr
    isgatfsvgsgsvyaygvmdrgysydleveqaydlarraiyqatyrdaysggavnlyhvr
    edgwirvssdnvadlhekysgstp
    

    Sequence, based on observed residues (ATOM records): (download)
    >5lf4K (K:)
    tttlafkfrhgvivaadsratagayiasqtvkkvieinpyllgtmaggaadcsfwerlla
    rqcriyelrnkerisvaaaskllanmvyqykgmglsmgtmicgwdkrgpglyyvdsegnr
    isgatfsvgsgsvyaygvmdrgysydleveqaydlarraiyqatyrdaysggavnlyhvr
    edgwirvssdnvadlhekys
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5lf4L (L:)
    rfspyvfnggtilaiagedfaivasdtrlsegfsihtrdspkcykltdktvigcsgfhgd
    cltltkiiearlkmykhsnnkamttgaiaamlstilysrrffpyyvyniiggldeegkga
    vysfdpvgsyqrdsfkaggsasamlqplldnqvgfknmqnvehvplsldramrlvkdvfi
    saaerdvytgdalricivtkegireetvslrkd
    

  • Chain 'M':
    Sequence, based on SEQRES records: (download)
    >5lf4M (M:)
    tqnpmvtgtsvlgvkfeggvviaadmlgsygslarfrnisrimrvnnstmlgasgdyadf
    qylkqvlgqmvideellgdghsyspraihswltramysrrskmnplwntmviggyadges
    flgyvdmlgvayeapslatgygaylaqpllrevlekqpvlsqteardlvercmrvlyyrd
    arsynrfqiatvtekgveiegplstetnwdiahmisgfe
    

    Sequence, based on observed residues (ATOM records): (download)
    >5lf4M (M:)
    tqnpmvtgtsvlgvkfeggvviaadmlgsygslarfrnisrimrvnnstmlgasgdyadf
    qylkqvlgqmvideellgdghsyspraihswltramysrrskmnplwntmviggyadges
    flgyvdmlgvayeapslatgygaylaqpllrevlekqpvlsqteardlvercmrvlyyrd
    arsynrfqiatvtekgveiegplstetnwdiahmis
    

  • Chain 'N':
    Sequence, based on SEQRES records: (download)
    >5lf4N (N:)
    ttimavqfdggvvlgadsrtttgsyianrvtdkltpihdrifccrsgsaadtqavadavt
    yqlgfhsielnepplvhtaaslfkemcyryredlmagiiiagwdpqeggqvysvpmggmm
    vrqsfaiggsgssyiygyvdatyregmtkeeclqftanalalamerdgssggvirlaaia
    esgverqvllgdqipkfavatlppa
    

    Sequence, based on observed residues (ATOM records): (download)
    >5lf4N (N:)
    ttimavqfdggvvlgadsrtttgsyianrvtdkltpihdrifccrsgsaadtqavadavt
    yqlgfhsielnepplvhtaaslfkemcyryredlmagiiiagwdpqeggqvysvpmggmm
    vrqsfaiggsgssyiygyvdatyregmtkeeclqftanalalamerdgssggvirlaaia
    esgverqvllgdqipkfavatl
    

  • Chain 'O':
    Sequence, based on SEQRES records: (download)
    >5lf4O (O:)
    maergysfslttfspsgklvqieyalaavaggapsvgikaangvvlatekkqksilyder
    svhkvepitkhiglvysgmgpdyrvlvhrarklaqqyylvyqepiptaqlvqrvasvmqe
    ytqsggvrpfgvsllicgwnegrpylfqsdpsgayfawkatamgknyvngktflekryne
    dleledaihtailtlkesfegqmtednievgicneagfrrltptevkdylaaia
    

    Sequence, based on observed residues (ATOM records): (download)
    >5lf4O (O:)
    rgysfslttfspsgklvqieyalaavaggapsvgikaangvvlatekkqksilydersvh
    kvepitkhiglvysgmgpdyrvlvhrarklaqqyylvyqepiptaqlvqrvasvmqeytq
    sggvrpfgvsllicgwnegrpylfqsdpsgayfawkatamgknyvngktflekrynedle
    ledaihtailtlkesfegqmtednievgicneagfrrltptevkdylaai
    

  • Chain 'P':
    Sequence, based on SEQRES records: (download)
    >5lf4P (P:)
    msrrydsrttifspegrlyqveyameaighagtclgilandgvllaaerrnihklldevf
    fsekiyklnedmacsvagitsdanvltnelrliaqryllqyqepipceqlvtalcdikqa
    ytqfggkrpfgvsllyigwdkhygfqlyqsdpsgnyggwkatcignnsaaavsmlkqdyk
    egemtlksalalaikvlnktmdvsklsaekveiatltrengktvirvlkqkeveqlikkh
    eeeeakaerekkekeqkekdk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5lf4P (P:)
    srrydsrttifspegrlyqveyameaighagtclgilandgvllaaerrnihklldevff
    sekiyklnedmacsvagitsdanvltnelrliaqryllqyqepipceqlvtalcdikqay
    tqfggkrpfgvsllyigwdkhygfqlyqsdpsgnyggwkatcignnsaaavsmlkqdyke
    gemtlksalalaikvlnktmdvsklsaekveiatltrengktvirvlkqkeveqlikkhe
    eeeakaer
    

  • Chain 'Q':
    Sequence, based on SEQRES records: (download)
    >5lf4Q (Q:)
    msydraitvfspdghlfqveyaqeavkkgstavgvrgrdivvlgvekksvaklqdertvr
    kicalddnvcmafagltadarivinrarvecqshrltvedpvtveyitryiaslkqrytq
    sngrrpfgisalivgfdfdgtprlyqtdpsgtyhawkanaigrgaksvrefleknytdea
    ietddltiklvikallevvqsggknielavmrrdqslkilnpeeiekyvaeiekekeene
    kkkqkkas
    

    Sequence, based on observed residues (ATOM records): (download)
    >5lf4Q (Q:)
    sydraitvfspdghlfqveyaqeavkkgstavgvrgrdivvlgvekksvaklqdertvrk
    icalddnvcmafagltadarivinrarvecqshrltvedpvtveyitryiaslkqrytqs
    ngrrpfgisalivgfdfdgtprlyqtdpsgtyhawkanaigrgaksvrefleknytdeai
    etddltiklvikallevvqsggknielavmrrdqslkilnpeeiekyvaeiekekeene
    

  • Chain 'R':
    Sequence, based on SEQRES records: (download)
    >5lf4R (R:)
    mfltrseydrgvntfspegrlfqveyaieaiklgstaigiqtsegvclavekritsplme
    pssiekiveidahigcamsgliadaktlidkarvetqnhwftynetmtvesvtqavsnla
    lqfgeedadpgamsrpfgvallfggvdekgpqlfhmdpsgtfvqcdaraigsasegaqss
    lqevyhksmtlkeaikssliilkqvmeeklnatnielatvqpgqnfhmftkeeleevikd
    i
    

    Sequence, based on observed residues (ATOM records): (download)
    >5lf4R (R:)
    drgvntfspegrlfqveyaieaiklgstaigiqtsegvclavekritsplmepssiekiv
    eidahigcamsgliadaktlidkarvetqnhwftynetmtvesvtqavsnlalqfgeeda
    dpgamsrpfgvallfggvdekgpqlfhmdpsgtfvqcdaraigsasegaqsslqevyhks
    mtlkeaikssliilkqvmeeklnatnielatvqpgqnfhmftkeeleevikdi
    

  • Chain 'S':
    Sequence, based on SEQRES records: (download)
    >5lf4S (S:)
    mfrnqydndvtvwspqgrihqieyameavkqgsatvglkskthavlvalkraqselaahq
    kkilhvdnhigisiagltadarllcnfmrqecldsrfvfdrplpvsrlvsligsktqipt
    qrygrrpygvglliagyddmgphifqtxpsanyfdcramsigarsqsartylerhmsefm
    ecnlnelvkhglralretlpaeqdlttknvsigivgkdleftiyddddvspflegleerp
    qrkaqpaqpadepaekadepmeh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5lf4S (S:)
    frnqydndvtvwspqgrihqieyameavkqgsatvglkskthavlvalkraqselaahqk
    kilhvdnhigisiagltadarllcnfmrqecldsrfvfdrplpvsrlvsligsktqiptq
    rygrrpygvglliagyddmgphifqtxpsanyfdcramsigarsqsartylerhmsefme
    cnlnelvkhglralretlpaeqdlttknvsigivgkdleftiyddddvspflegleer
    

  • Chain 'T':
    Sequence, based on SEQRES records: (download)
    >5lf4T (T:)
    mssigtgydlsastfspdgrvfqveyamkavensstaigirckdgvvfgveklvlsklye
    egsnkrlfnvdrhvgmavaglladarsladiareeasnfrsnfgyniplkhladrvamyv
    haytlysavrpfgcsfmlgsysvndgaqlymidpsgvsygywgcaigkarqaakteiekl
    qmkemtcrdivkevakiiyivhdevkdkafelelswvgeltngrheivpkdireeaekya
    keslkeedesdddnm
    

    Sequence, based on observed residues (ATOM records): (download)
    >5lf4T (T:)
    tgydlsastfspdgrvfqveyamkavensstaigirckdgvvfgveklvlsklyeegsnk
    rlfnvdrhvgmavaglladarsladiareeasnfrsnfgyniplkhladrvamyvhaytl
    ysavrpfgcsfmlgsysvndgaqlymidpsgvsygywgcaigkarqaakteieklqmkem
    tcrdivkevakiiyivhdevkdkafelelswvgeltngrheivpkdireeaekyakeslk
    

  • Chain 'U':
    Sequence, based on SEQRES records: (download)
    >5lf4U (U:)
    msrgssagfdrhitifspegrlyqveyafkainqggltsvavrgkdxavivtqkkvpdkl
    ldsstvthlfkitenigcvmtgmtadsrsqvqraryeaanwkykygyeipvdmlckriad
    isqvytqnaemrplgccmiligideeqgpqvykcdpagyyxgfkataagvkqtestsfle
    kkvkkkfdwtfeqtvetaitclstvlsidfkpseievgvvtvenpkfrilteaeidahlv
    alaerd
    

    Sequence, based on observed residues (ATOM records): (download)
    >5lf4U (U:)
    srgssagfdrhitifspegrlyqveyafkainqggltsvavrgkdxavivtqkkvpdkll
    dsstvthlfkitenigcvmtgmtadsrsqvqraryeaanwkykygyeipvdmlckriadi
    sqvytqnaemrplgccmiligideeqgpqvykcdpagyyxgfkataagvkqtestsflek
    kvkkkqtvetaitclstvlsidfkpseievgvvtvenpkfrilteaeidahlvalaer
    

  • Chain 'V':
    Sequence, based on SEQRES records: (download)
    >5lf4V (V:)
    ttiagvvykdgivlgadtrategmvvadkncskihfispniyccgagtaadtdmttqlis
    snlelhslstgrlprvvtanrmlkqmlfryqgyigaalvlggvdvtgphlysiyphgstd
    klpyvtmgsgslaamavfedkfrpdmeeeeaknlvseaiaagifndlgsgsnidlcvisk
    nkldflrpytvpnkkgtrlgryrcekgttavltekitpleievleetvqtmdts
    

    Sequence, based on observed residues (ATOM records): (download)
    >5lf4V (V:)
    ttiagvvykdgivlgadtrategmvvadkncskihfispniyccgagtaadtdmttqlis
    snlelhslstgrlprvvtanrmlkqmlfryqgyigaalvlggvdvtgphlysiyphgstd
    klpyvtmgsgslaamavfedkfrpdmeeeeaknlvseaiaagifndlgsgsnidlcvisk
    nkldflrpytvpnkkgtrlgryrcekgttavltekitple
    

  • Chain 'W':
    Sequence, based on SEQRES records: (download)
    >5lf4W (W:)
    msimsynggavmamkgkncvaiaadrrfgiqaqmvttdfqkifpmgdrlyiglaglatdv
    qtvaqrlkfrlnlyelkegrqikpytlmsmvanllyekrfgpyytepviagldpktfkpf
    icsldligcpmvtddfvvsgtcaeqmygmceslwepnmdpdhlfetisqamlnavdrdav
    sgmgvivhiiekdkittrtlkarmd
    

    Sequence, based on observed residues (ATOM records): (download)
    >5lf4W (W:)
    simsynggavmamkgkncvaiaadrrfgiqaqmvttdfqkifpmgdrlyiglaglatdvq
    tvaqrlkfrlnlyelkegrqikpytlmsmvanllyekrfgpyytepviagldpktfkpfi
    csldligcpmvtddfvvsgtcaeqmygmceslwepnmdpdhlfetisqamlnavdrdavs
    gmgvivhiiekdkittrtlkarmd
    

  • Chain 'X':
    Sequence, based on SEQRES records: (download)
    >5lf4X (X:)
    meyligiqgpdyvlvasdrvaasnivqmkddhdkmfkmsekilllcvgeagdtvqfaeyi
    qknvqlykmrngyelsptaaanftrrnladxlrsrtpyhvnlllagydehegpalyymdy
    laalakapfaahgygafltlsildryytptisreravellrkcleelqkrfilnlptfsv
    riidkngihdldnisfpkqgs
    

    Sequence, based on observed residues (ATOM records): (download)
    >5lf4X (X:)
    meyligiqgpdyvlvasdrvaasnivqmkddhdkmfkmsekilllcvgeagdtvqfaeyi
    qknvqlykmrngyelsptaaanftrrnladxlrsrtpyhvnlllagydehegpalyymdy
    laalakapfaahgygafltlsildryytptisreravellrkcleelqkrfilnlptfsv
    riidkngihdldnisf
    

  • Chain 'Y':
    Sequence, based on SEQRES records: (download)
    >5lf4Y (Y:)
    tttlafkfrhgvivaadsratagayiasqtvkkvieinpyllgtmaggaadcsfwerlla
    rqcriyelrnkerisvaaaskllanmvyqykgmglsmgtmicgwdkrgpglyyvdsegnr
    isgatfsvgsgsvyaygvmdrgysydleveqaydlarraiyqatyrdaysggavnlyhvr
    edgwirvssdnvadlhekysgstp
    

    Sequence, based on observed residues (ATOM records): (download)
    >5lf4Y (Y:)
    tttlafkfrhgvivaadsratagayiasqtvkkvieinpyllgtmaggaadcsfwerlla
    rqcriyelrnkerisvaaaskllanmvyqykgmglsmgtmicgwdkrgpglyyvdsegnr
    isgatfsvgsgsvyaygvmdrgysydleveqaydlarraiyqatyrdaysggavnlyhvr
    edgwirvssdnvadlhekysg
    

  • Chain 'Z':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5lf4Z (Z:)
    rfspyvfnggtilaiagedfaivasdtrlsegfsihtrdspkcykltdktvigcsgfhgd
    cltltkiiearlkmykhsnnkamttgaiaamlstilysrrffpyyvyniiggldeegkga
    vysfdpvgsyqrdsfkaggsasamlqplldnqvgfknmqnvehvplsldramrlvkdvfi
    saaerdvytgdalricivtkegireetvslrkd
    

  • Chain 'a':
    No sequence available.

  • Chain 'b':
    No sequence available.