PDB entry 5lev

View 5lev on RCSB PDB site
Description: crystal structure of human udp-n-acetylglucosamine-dolichyl-phosphate n-acetylglucosaminephosphotransferase (dpagt1) (v264g mutant)
Deposited on 2016-06-30, released 2016-12-28
The last revision was dated 2019-11-20, with a file datestamp of 2019-11-15.
Experiment type: XRAY
Resolution: 3.2 Å
R-factor: N/A
AEROSPACI score: 0.11 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: UDP-N-acetylglucosamine--dolichyl-phosphate N-acetylglucosaminephosphotransferase
    Species: Homo sapiens [TaxId:9606]
    Gene: DPAGT1, DPAGT2
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9H3H5
      • engineered mutation (264)
  • Heterogens: UNL, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >5levA (A:)
    smwafselpmpllinlivsllgfvatvtlipafrghfiaarlcgqdlnktsrqqipesqg
    visgavfliilfcfipfpflncfvkeqckafphhefvaligallaiccmiflgfaddvln
    lrwrhklllptaaslpllmvyftnfgnttivvpkpfrpilglhldlgilyyvymgllavf
    ctnainilagingleagqslvisasiivfnlvelegdcrddhvfslyfmipfffttlgll
    yhnwypsrvfvgdtfcyfagmtfagvgilghfsktmllffmpqvfnflyslpqllhiipc
    prhriprlniktgklemsyskfktkslsflgtfilkvaeslqlvtvhqsetedgeftecn
    nmtlinlllkvlgpihernltllllllqilgsaitfsiryqlvrlfydv
    

    Sequence, based on observed residues (ATOM records):
    >5levA (A:)
    pmpllinlivsllgfvatvtlipafrghfiaarlcgqdlnktsrqqipesqgvisgavfl
    iilfcfipfpflphhefvaligallaiccmiflgfaddvlnlrwrhklllptaaslpllm
    vyftnfgnttivvhldlgilyyvymgllavfctnainilagingleagqslvisasiivf
    nlvelegdcrddhvfslyfmipfffttlgllyhnwypsrvfvgdtfcyfagmtfagvgil
    ghfsktmllffmpqvfnflyslpqllhiipcprhriprlniktgklemsyskfktkslsf
    lgtfilkvaeslqlvtvhqsetedgeftecnnmtlinlllkvlgpihernltllllllqi
    lgsaitfsiryqlvr