PDB entry 5lef

View 5lef on RCSB PDB site
Description: Rab6A:Kif20A complex
Class: protein transport
Keywords: Rab GTPase, kinesin, motor, protein complex, protein transport
Deposited on 2016-06-29, released 2017-11-15
The last revision prior to the SCOPe 2.06 freeze date was dated 2017-11-15, with a file datestamp of 2017-11-10.
Experiment type: XRAY
Resolution: 2.09 Å
R-factor: N/A
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ras-related protein Rab-6A
    Species: Homo sapiens [TaxId:9606]
    Gene: RAB6A, RAB6
    Database cross-references and differences (RAF-indexed):
    • Uniprot P20340
      • engineered mutation (67)
    Domains in SCOPe 2.06: d5lefa_
  • Chain 'B':
    Compound: Ras-related protein Rab-6A
    Species: Homo sapiens [TaxId:9606]
    Gene: RAB6A, RAB6
    Database cross-references and differences (RAF-indexed):
    • Uniprot P20340
      • engineered mutation (67)
    Domains in SCOPe 2.06: d5lefb_
  • Chain 'C':
    Compound: Kinesin-like protein KIF20A
    Species: Mus musculus [TaxId:10090]
    Gene: Kif20a, Rab6kifl
    Database cross-references and differences (RAF-indexed):
    • Uniprot P97329 (3-End)
      • expression tag (0-2)
  • Chain 'D':
    Compound: Kinesin-like protein KIF20A
    Species: Mus musculus [TaxId:10090]
    Gene: Kif20a, Rab6kifl
    Database cross-references and differences (RAF-indexed):
    • Uniprot P97329 (3-End)
      • expression tag (0-2)
  • Heterogens: GTP, MG, SO4, GOL, IPA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5lefA (A:)
    gamgnplrkfklvflgeqsvgktslitrfmydsfdntyqatigidflsktmyledrtvrl
    qlwdtaglerfrslipsyirdstvavvvyditnvnsfqqttkwiddvrtergsdviimlv
    gnktdladkrqvsieegerkakelnvmfietsakagynvkqlfrrvaaalpgmestqdrs
    redmidiklek
    

    Sequence, based on observed residues (ATOM records): (download)
    >5lefA (A:)
    lrkfklvflgeqsvgktslitrfmydsfdntyqatigidflsktmyledrtvrlqlwdta
    glerfrslipsyirdstvavvvyditnvnsfqqttkwiddvrtergsdviimlvgnktdl
    adkrqvsieegerkakelnvmfietsakagynvkqlfrrvaaalpg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5lefB (B:)
    gamgnplrkfklvflgeqsvgktslitrfmydsfdntyqatigidflsktmyledrtvrl
    qlwdtaglerfrslipsyirdstvavvvyditnvnsfqqttkwiddvrtergsdviimlv
    gnktdladkrqvsieegerkakelnvmfietsakagynvkqlfrrvaaalpgmestqdrs
    redmidiklek
    

    Sequence, based on observed residues (ATOM records): (download)
    >5lefB (B:)
    fklvflgeqsvgktslitrfmydsfdntyqatigidflsktmdrtvrlqlwdtaglerfr
    slipsyirdstvavvvyditnvnsfqqttkwiddvrtergsdviimlvgnktdladkrqv
    sieegerkakelnvmfietsakagynvkqlfrrvaaalp
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.