PDB entry 5le3

View 5le3 on RCSB PDB site
Description: crystal structure of darpin-darpin rigid fusion, variant dd_d12_09_d12
Deposited on 2016-06-29, released 2017-08-02
The last revision was dated 2019-09-18, with a file datestamp of 2019-09-13.
Experiment type: XRAY
Resolution: 3.5 Å
R-factor: N/A
AEROSPACI score: 0.1 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: dd_d12_09_d12
    Species: synthetic construct, synthetic [TaxId:32630]
    Database cross-references and differences (RAF-indexed):
    • PDB 5LE3 (Start-316)
  • Chain 'B':
    Compound: dd_d12_09_d12
    Species: synthetic construct, synthetic [TaxId:32630]
    Database cross-references and differences (RAF-indexed):
    • PDB 5LE3 (Start-316)
  • Chain 'C':
    Compound: dd_d12_09_d12
    Species: synthetic construct, synthetic [TaxId:32630]
    Database cross-references and differences (RAF-indexed):
    • PDB 5LE3 (Start-316)
  • Chain 'D':
    Compound: dd_d12_09_d12
    Species: synthetic construct, synthetic [TaxId:32630]
    Database cross-references and differences (RAF-indexed):
    • PDB 5LE3 (Start-316)

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >5le3A (A:)
    mrgshhhhhhgsdlgkklleaaragqddevrillangadvntadetgftplhlaaweghl
    givevllkngadvnanderghtplhlaaytghleivevllkngagvnatdvigtaplhla
    amwghleivevllkngadvsaqdkfgktpgdlagdngnewiakklllaaareghreaver
    aikagadvntadetgftplhlaaweghlgivevllkngadvnanderghtplhlaaytgh
    leivevllkngagvnatdvigtaplhlaamwghleivevllkhgadvnaqdkfgktpfdl
    aidngnediaevlqkaa
    

    Sequence, based on observed residues (ATOM records):
    >5le3A (A:)
    sdlgkklleaaragqddevrillangadvntadetgftplhlaaweghlgivevllknga
    dvnanderghtplhlaaytghleivevllkngagvnatdvigtaplhlaamwghleivev
    llkngadvsaqdkfgktpgdlagdngnewiakklllaaareghreaveraikagadvnta
    detgftplhlaaweghlgivevllkngadvnanderghtplhlaaytghleivevllkng
    agvnatdvigtaplhlaamwghleivevllkhgadvnaqdkfgktpfdlaidngnediae
    vlqkaa
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >5le3B (B:)
    mrgshhhhhhgsdlgkklleaaragqddevrillangadvntadetgftplhlaaweghl
    givevllkngadvnanderghtplhlaaytghleivevllkngagvnatdvigtaplhla
    amwghleivevllkngadvsaqdkfgktpgdlagdngnewiakklllaaareghreaver
    aikagadvntadetgftplhlaaweghlgivevllkngadvnanderghtplhlaaytgh
    leivevllkngagvnatdvigtaplhlaamwghleivevllkhgadvnaqdkfgktpfdl
    aidngnediaevlqkaa
    

    Sequence, based on observed residues (ATOM records):
    >5le3B (B:)
    sdlgkklleaaragqddevrillangadvntadetgftplhlaaweghlgivevllknga
    dvnanderghtplhlaaytghleivevllkngagvnatdvigtaplhlaamwghleivev
    llkngadvsaqdkfgktpgdlagdngnewiakklllaaareghreaveraikagadvnta
    detgftplhlaaweghlgivevllkngadvnanderghtplhlaaytghleivevllkng
    agvnatdvigtaplhlaamwghleivevllkhgadvnaqdkfgktpfdlaidngnediae
    vlqkaa
    

  • Chain 'C':
    Sequence, based on SEQRES records:
    >5le3C (C:)
    mrgshhhhhhgsdlgkklleaaragqddevrillangadvntadetgftplhlaaweghl
    givevllkngadvnanderghtplhlaaytghleivevllkngagvnatdvigtaplhla
    amwghleivevllkngadvsaqdkfgktpgdlagdngnewiakklllaaareghreaver
    aikagadvntadetgftplhlaaweghlgivevllkngadvnanderghtplhlaaytgh
    leivevllkngagvnatdvigtaplhlaamwghleivevllkhgadvnaqdkfgktpfdl
    aidngnediaevlqkaa
    

    Sequence, based on observed residues (ATOM records):
    >5le3C (C:)
    sdlgkklleaaragqddevrillangadvntadetgftplhlaaweghlgivevllknga
    dvnanderghtplhlaaytghleivevllkngagvnatdvigtaplhlaamwghleivev
    llkngadvsaqdkfgktpgdlagdngnewiakklllaaareghreaveraikagadvnta
    detgftplhlaaweghlgivevllkngadvnanderghtplhlaaytghleivevllkng
    agvnatdvigtaplhlaamwghleivevllkhgadvnaqdkfgktpfdlaidngnediae
    vlqkaa
    

  • Chain 'D':
    Sequence, based on SEQRES records:
    >5le3D (D:)
    mrgshhhhhhgsdlgkklleaaragqddevrillangadvntadetgftplhlaaweghl
    givevllkngadvnanderghtplhlaaytghleivevllkngagvnatdvigtaplhla
    amwghleivevllkngadvsaqdkfgktpgdlagdngnewiakklllaaareghreaver
    aikagadvntadetgftplhlaaweghlgivevllkngadvnanderghtplhlaaytgh
    leivevllkngagvnatdvigtaplhlaamwghleivevllkhgadvnaqdkfgktpfdl
    aidngnediaevlqkaa
    

    Sequence, based on observed residues (ATOM records):
    >5le3D (D:)
    sdlgkklleaaragqddevrillangadvntadetgftplhlaaweghlgivevllknga
    dvnanderghtplhlaaytghleivevllkngagvnatdvigtaplhlaamwghleivev
    llkngadvsaqdkfgktpgdlagdngnewiakklllaaareghreaveraikagadvnta
    detgftplhlaaweghlgivevllkngadvnanderghtplhlaaytghleivevllkng
    agvnatdvigtaplhlaamwghleivevllkhgadvnaqdkfgktpfdlaidngnediae
    vlqkaa