PDB entry 5le1

View 5le1 on RCSB PDB site
Description: VIM-2 metallo-beta-lactamase in complex with 2-(2-chloro-6-fluorobenzyl)-3-oxoisoindoline-4-carboxylic acid (compound 16)
Class: hydrolase
Keywords: metallo-beta-lactamase, inhibitor, complex, antibiotic resistance, HYDROLASE
Deposited on 2016-06-29, released 2017-02-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-05-24, with a file datestamp of 2017-05-19.
Experiment type: XRAY
Resolution: 1.4 Å
R-factor: N/A
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Metallo-beta-lactamase VIM-2
    Species: Pseudomonas aeruginosa [TaxId:287]
    Gene: blaVIM-2, bla vim-2, bla-VIM-2, blasVIM-2, blaVIM2, blm, VIM-2, vim-2, PAERUG_P32_London_17_VIM_2_10_11_06255
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5le1a_
  • Heterogens: ZN, 6UW, FMT, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5le1A (A:)
    mfkllskllvyltasimaiasplafsvdssgeyptvseipvgevrlyqiadgvwshiatq
    sfdgavypsnglivrdgdelllidtawgakntaallaeiekqiglpvtravsthfhddrv
    ggvdvlraagvatyaspstrrlaevegneipthsleglsssgdavrfgpvelfypgaahs
    tdnlvvyvpsasvlyggcaiyelsrtsagnvadadlaewptsieriqqhypeaqfvipgh
    glpggldllkhttnvvkahtnrsvve
    

    Sequence, based on observed residues (ATOM records): (download)
    >5le1A (A:)
    geyptvseipvgevrlyqiadgvwshiatqsfdgavypsnglivrdgdelllidtawgak
    ntaallaeiekqiglpvtravsthfhddrvggvdvlraagvatyaspstrrlaevegnei
    pthsleglsssgdavrfgpvelfypgaahstdnlvvyvpsasvlyggcaiyelsrtsagn
    vadadlaewptsieriqqhypeaqfvipghglpggldllkhttnvvkahtn