PDB entry 5ldy

View 5ldy on RCSB PDB site
Description: structure of yersinia pseudotuberculosis invd
Deposited on 2016-06-28, released 2017-06-14
The last revision was dated 2020-06-17, with a file datestamp of 2020-06-12.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: N/A
AEROSPACI score: 0.18 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ig domain protein group 1 domain protein
    Species: Yersinia pseudotuberculosis [TaxId:502800]
    Gene: YPK_1315
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Ig domain protein group 1 domain protein
    Species: Yersinia pseudotuberculosis [TaxId:502800]
    Gene: YPK_1315
    Database cross-references and differences (RAF-indexed):
    • Uniprot A0A0H3B1G5 (20-356)
      • expression tag (18-19)
  • Heterogens: PO4, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >5ldyA (A:)
    mghhhhhhvdenlyfqgggrgnlsttnstlvaapvnieanssdtsvvtltlrdnnnnpvt
    gqtvvftstlgtlgnvteqasglytatltagtvsgvaslsvsvggnalgvtgnitlapga
    ldaarsilavnkpsinaddrigstitftaqdaqgnaitgldiafmtdlensqimtlvdhn
    dgtytaningtqtgianiavqssgatiaglaatmvtitpgawnttqatpvmtvalpittc
    qsssgvykryyigivthelydnygneisgiltynlgagryttvtsqnssvsgsngltrrs
    nspvshfiltsdaytsqaacyaerianvnvtitvtaitddfktsavnkvfilgtgsn
    

    Sequence, based on observed residues (ATOM records):
    >5ldyA (A:)
    lsttnstlvaapvnieanssdtsvvtltlrdnnnnpvtgqtvvftstlgtlgnvteqasg
    lytatltagtvsgvaslsvsvggnalgvtgnitlapgaldaarsilavnkpsinaddrig
    stitftaqdaqgnaitgldiafmtdlensqimtlvdhndgtytaningtqtgianiavqs
    sgatiaglaatmvtitpgawnttqatpvmtvalpittcqsssgvykryyigivthelydn
    ygneisgiltynlgagryttvtsqnssvsgsngltrrsnspvshfiltsdaytsqaacya
    erianvnvtitvtaitddfktsavnkvfilgtgsn
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >5ldyB (B:)
    mghhhhhhvdenlyfqgggrgnlsttnstlvaapvnieanssdtsvvtltlrdnnnnpvt
    gqtvvftstlgtlgnvteqasglytatltagtvsgvaslsvsvggnalgvtgnitlapga
    ldaarsilavnkpsinaddrigstitftaqdaqgnaitgldiafmtdlensqimtlvdhn
    dgtytaningtqtgianiavqssgatiaglaatmvtitpgawnttqatpvmtvalpittc
    qsssgvykryyigivthelydnygneisgiltynlgagryttvtsqnssvsgsngltrrs
    nspvshfiltsdaytsqaacyaerianvnvtitvtaitddfktsavnkvfilgtgsn
    

    Sequence, based on observed residues (ATOM records):
    >5ldyB (B:)
    grgnlsttnstlvaapvnieanssdtsvvtltlrdnnnnpvtgqtvvftstlgtlgnvte
    qasglytatltagtvsgvaslsvsvggnalgvtgnitlapgaldaarsilavnkpsinad
    drigstitftaqdaqgnaitgldiafmtdlensqimtlvdhndgtytaningtqtgiani
    avqssgatiaglaatmvtitpgawnttqatpvmtvalpittcqsssgvykryyigivthe
    lydnygneisgiltynlgagryttvtsqnssvsgsngltrrsnspvshfiltsdaytsqa
    acyaerianvnvtitvtaitddfktsavnkvfilgtgsn