PDB entry 5ldx

View 5ldx on RCSB PDB site
Description: structure of mammalian respiratory complex i, class3.
Deposited on 2016-06-28, released 2016-09-14
The last revision was dated 2019-10-23, with a file datestamp of 2019-10-18.
Experiment type: EM
Resolution: 5.6 Å
R-factor: N/A
AEROSPACI score: -0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: NADH-ubiquinone oxidoreductase chain 3
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: nadh dehydrogenase [ubiquinone] iron-sulfur protein 7, mitochondrial
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: nadh dehydrogenase [ubiquinone] iron-sulfur protein 3, mitochondrial
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: nadh dehydrogenase [ubiquinone] iron-sulfur protein 2, mitochondrial
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P17694 (Start-428)
      • conflict (127)
  • Chain 'E':
    Compound: nadh dehydrogenase [ubiquinone] flavoprotein 2, mitochondrial
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed):
  • Chain 'F':
    Compound: nadh dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed):
  • Chain 'G':
    Compound: NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial,NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial,NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial,NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P15690 (0-201)
    • PDB 5LDX (202-End)
  • Chain 'H':
    Compound: NADH-ubiquinone oxidoreductase chain 1
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed):
  • Chain 'I':
    Compound: nadh dehydrogenase [ubiquinone] iron-sulfur protein 8, mitochondrial
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed):
  • Chain 'J':
    Compound: NADH-ubiquinone oxidoreductase chain 6
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed):
  • Chain 'K':
    Compound: NADH-ubiquinone oxidoreductase chain 4L
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed):
  • Chain 'L':
    Compound: NADH-ubiquinone oxidoreductase chain 5
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed):
  • Chain 'M':
    Compound: NADH-ubiquinone oxidoreductase chain 4
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed):
  • Chain 'N':
    Compound: NADH-ubiquinone oxidoreductase chain 2
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed):
  • Chain 'O':
    Compound: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 10, mitochondrial,NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 10, mitochondrial,NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 10, mitochondrial
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed):
    • PDB 5LDX (0-85)
    • Uniprot P34942 (86-313)
  • Chain 'P':
    Compound: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9, NDUFA9
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed):
    • PDB 5LDX (0-282)
  • Chain 'Q':
    Compound: NADH dehydrogenase [ubiquinone] iron-sulfur protein 4, NDUFS4
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed):
    • PDB 5LDX (0-112)
  • Chain 'R':
    Compound: NADH dehydrogenase [ubiquinone] iron-sulfur protein 6, mitochondrial,NADH dehydrogenase [ubiquinone] iron-sulfur protein 6, mitochondrial,NADH dehydrogenase [ubiquinone] iron-sulfur protein 6, mitochondrial
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed):
    • PDB 5LDX (0-53)
    • Uniprot P23934 (54-88)
  • Chain 'S':
    Compound: nadh dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 2
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed):
  • Chain 'T':
    Compound: acyl carrier protein, mitochondrial
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed):
  • Chain 'U':
    Compound: acyl carrier protein, mitochondrial
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed):
  • Chain 'V':
    Compound: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 5
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed):
  • Chain 'W':
    Compound: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 6
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed):
  • Chain 'X':
    Compound: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 8,NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 8,NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 8
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P42029 (0-108)
    • PDB 5LDX (109-163)
  • Chain 'Y':
    Compound: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 11
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed):
  • Chain 'Z':
    Compound: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13,NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13,NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13,NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13,NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13,NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13,NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed):
    • PDB 5LDX (0-25)
    • Uniprot Q95KV7 (26-94)
    • PDB 5LDX (95-137)
  • Chain 'a':
    Compound: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 1
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed):
  • Chain 'b':
    Compound: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 3,NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 3,NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 3
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q02371 (0-44)
    • PDB 5LDX (45-79)
  • Chain 'c':
    Compound: NADH dehydrogenase [ubiquinone] 1 subunit C1, mitochondrial
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed):
  • Chain 'd':
    Compound: NADH dehydrogenase [ubiquinone] 1 subunit C2,NADH dehydrogenase [ubiquinone] 1 subunit C2,NADH dehydrogenase [ubiquinone] 1 subunit C2,NADH dehydrogenase [ubiquinone] 1 subunit C2,NADH dehydrogenase [ubiquinone] 1 subunit C2,NADH dehydrogenase [ubiquinone] 1 subunit C2,NADH dehydrogenase [ubiquinone] 1 subunit C2
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed):
    • PDB 5LDX (0-25)
    • Uniprot Q02827 (26-94)
    • PDB 5LDX (95-113)
  • Chain 'e':
    Compound: NADH dehydrogenase [ubiquinone] iron-sulfur protein 5
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed):
  • Chain 'f':
    Compound: NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 1
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed):
  • Chain 'g':
    Compound: NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 11, mitochondrial
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed):
  • Chain 'h':
    Compound: NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 5, mitochondrial,NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 5, mitochondrial,NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 5, mitochondrial
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q02380 (0-38)
    • PDB 5LDX (39-133)
  • Chain 'i':
    Compound: NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 6,NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 6,NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 6
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q02367 (0-26)
    • PDB 5LDX (27-105)
  • Chain 'j':
    Compound: NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 2, NDUFB2
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed):
    • PDB 5LDX (0-51)
  • Chain 'k':
    Compound: NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 3, NDUFB3
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed):
    • PDB 5LDX (0-73)
  • Chain 'l':
    Compound: NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 8, NDUFB8
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed):
    • PDB 5LDX (0-117)
  • Chain 'm':
    Compound: NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 4,NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 4,NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 4
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed):
    • PDB 5LDX (0-20)
    • Uniprot P48305 (21-117)
  • Chain 'n':
    Compound: NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 9,NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 9,NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 9
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q02369 (0-126)
    • PDB 5LDX (127-165)
  • Chain 'o':
    Compound: NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 7
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed):
  • Chain 'p':
    Compound: NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 10,NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 10,NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 10,NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 10,NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 10,NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 10,NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 10
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed):
    • PDB 5LDX (0-71)
    • Uniprot Q02373 (72-138)
    • PDB 5LDX (139-168)
  • Chain 'q':
    Compound: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 12
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed):
  • Chain 'r':
    Compound: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 7, NDUFA7
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed):
    • PDB 5LDX (0-86)
  • Chain 's':
    Compound: NADH dehydrogenase [ubiquinone] flavoprotein 3, NDUFV3
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed):
    • PDB 5LDX (0-34)
  • Heterogens: SF4, FES, FMN, NAP, ZN

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >5ldxA (A:)
    mnlmlalltnftlatllviiafwlpqlnvysektspyecgfdpmgsarlpfsmkfflvai
    tfllfdleialllplpwasqtanlntmltmalfliillavslayewtqkglewte
    

    Sequence, based on observed residues (ATOM records):
    >5ldxA (A:)
    nlmlalltnftlatllviiafwlpqlfsmkfflvaitfllfdleialllplpwasqtanl
    ntmltmalfliillavslayewtqkgle
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >5ldxB (B:)
    psstqpavsqaravvpkpaalpssrgeyvvaklddlinwarrsslwpmtfglaccavemm
    hmaaprydmdrfgvvfrasprqsdvmivagtltnkmapalrkvydqmpepryvvsmgsca
    ngggyyhysysvvrgcdrivpvdiyvpgcpptaeallygilqlqkkikrekrlriwyrr
    

    Sequence, based on observed residues (ATOM records):
    >5ldxB (B:)
    eyvvaklddlinwarrsslwpmtfglaccavemmhmaaprydmdrfgvvfrasprqsdvm
    ivagtltnkmapalrkvydqmpepryvvsmgscangggyyhysysvvrgcdrivpvdiyv
    pgcpptaeallygilqlqkkikrekrl
    

  • Chain 'C':
    Sequence, based on SEQRES records:
    >5ldxC (C:)
    essaadtrptvrprndvahkqlsafgeyvaeilpkyvqqvqvscfneleicihpdgvipv
    ltflrdhsnaqfksladltavdiptrqnrfeivynllslrfnsrirvktytdeltpiess
    vpvykaanwyereiwdmfgvffanhpdlrriltdygfeghpfrkdfplsgyvelryddev
    krvvaepvelaqefrkfdlnspweafpayrqppeslkleagdtkpeak
    

    Sequence, based on observed residues (ATOM records):
    >5ldxC (C:)
    rptvrprndvahkqlsafgeyvaeilpkyvqqvqvscfneleicihpdgvipvltflrdh
    snaqfksladltavdiptrqnrfeivynllslrfnsrirvktytdeltpiessvpvykaa
    nwyereiwdmfgvffanhpdlrriltdygfeghpfrkdfplsgyvelryddevkrvvaep
    velaqefrkfdlnspweafpayrqpp
    

  • Chain 'D':
    Sequence, based on SEQRES records:
    >5ldxD (D:)
    rqwqpdvewaeqyggavmyptketahwkpppwndvdppkdtlvsnltlnfgpqhpaahgv
    lrlvmelsgemvrkcdphigllhrgteklieyktylqalpyfdrldyvsmmcneqaysla
    vekllnirpppraqwirvlfgeitrllnhimavtthaldigamtpffwmfeerekmfefy
    ervsgarmhaayvrpggvhqdlplglmddiyefsknfslrideleemltnnriwrnrtvd
    igivtaedalnygfsgvmlrgsgiqwdlrktqpydvydqvefdvpigsrgdcydrylcrv
    eemrqsiriisqclnkmppgeikvddakvsppkraemktsmeslihhfklytegyqvppg
    atytaieapkgefgvylvsdgssrpyrckikapgfahlagldkmskghmladvvaiigtq
    divfgevdr
    

    Sequence, based on observed residues (ATOM records):
    >5ldxD (D:)
    qpdvewaeqyggavmyptketahwkpppwndvdppkdtlvsnltlnvlrlvmelsgemvr
    kcdphigllhrgteklieyktylqalpyfdrldyvsmmcneqayslavekllnirpppra
    qwirvlfgeitrllnhimavtthaldigamtpffwmfeerekmfefyervsgarmhaayv
    rpggvhqdlplglmddiyefsknfslrideleemltnnriwrnrtvdigivtaedalnyg
    fsgvmlrgsgiqwdlrktqpydvydqvefdvpigsrgdcydrylcrveemrqsiriisqc
    lnkmppgeikvddakvsppkraemktsmeslihhfklytegyqvppgatytaieapkgef
    gvylvsdgssrpyrckikapgfahlagldkmskghmladvvaiigtqdivfgevdr
    

  • Chain 'E':
    Sequence, based on SEQRES records:
    >5ldxE (E:)
    gaggalfvhrdtpennpetpfdftpenykrieaivknypeghkaaavlpvldlaqrqngw
    lpisamnkvaeilqvppmrvyevatfytmynrkpvgkyhiqvctttpcmlrnsdsileai
    qkklgikvgettpdklftlieveclgacvnapmvqindnyyedltpkdieeiidelkagk
    ipkpgprsgrfscepaggltslteppkgpgfgvqagl
    

    Sequence, based on observed residues (ATOM records):
    >5ldxE (E:)
    vhrdtpennpetpfdftpenykrieaivknypeghkaaavlpvldlaqrqngwlpisamn
    kvaeilqvppmrvyevatfytmynrkpvgkyhiqvctttpcmlrnsdsileaiqkklgik
    vgettpdklftlieveclgacvnapmvqindnyyedltpkdieeiidelkagkipkpgpr
    sgrfsc
    

  • Chain 'F':
    Sequence, based on SEQRES records:
    >5ldxF (F:)
    sgdttapkktsfgslkdedriftnlygrhdwrlkgaqsrgdwyktkeillkgpdwilgev
    ktsglrgrggagfptglkwsfmnkpsdgrpkylvvnadegepgtckdreiirhdphklve
    gclvggramgaraayiyirgefyneasnlqvaireayeagligknacgsgydfdvfvvrg
    agayicgeetaliesiegkqgkprlkppfpadvgvfgcpttvanvetvavspticrrgga
    wfasfgrernsgtklfnisghvnnpctveeemsvplkeliekhaggvtggwdnllavipg
    gsstplipksvcetvlmdfdaliqaqtglgtaavivmdrstdivkaiarliefykhescg
    qctpcregvdwmnkvmarfvrgdarpaeidslweiskqieghticalgdgaawpvqglir
    hfrpeleermqqfaqqhqarqaaf
    

    Sequence, based on observed residues (ATOM records):
    >5ldxF (F:)
    slkdedriftnlygrhdwrlkgaqsrgdwyktkeillkgpdwilgevktsglrgrggagf
    ptglkwsfmnkpsdgrpkylvvnadegepgtckdreiirhdphklvegclvggramgara
    ayiyirgefyneasnlqvaireayeagligknacgsgydfdvfvvrgagayicgeetali
    esiegkqgkprlkppfpadvgvfgcpttvanvetvavspticrrggawfasfgrernsgt
    klfnisghvnnpctveeemsvplkeliekhaggvtggwdnllavipggsstplipksvce
    tvlmdfdaliqaqtglgtaavivmdrstdivkaiarliefykhescgqctpcregvdwmn
    kvmarfvrgdarpaeidslweiskqieghticalgdgaawpvqglirhfrpeleermqqf
    aqqhq
    

  • Chain 'G':
    Sequence, based on SEQRES records:
    >5ldxG (G:)
    lievfvdgqsvmvepgttvlqacekvgmqiprfcyherlsvagncrmclveiekapkvva
    acampvmkgwniltnsektkkaregvmefllanhpldcpicdqggecdlqdqsmmfgsdr
    srflegkravedknigplvktimtrciqctrcirfaseiagvddlgttgrgndmqvgtyi
    ekmfmselsgniidicpvgaltxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
    xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
    xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
    xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
    xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
    xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
    xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
    xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
    xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
    

    Sequence, based on observed residues (ATOM records):
    >5ldxG (G:)
    lievfvdgqsvmvepgttvlqacekvgmqiprfcyherlsvagncrmclveiekapkvva
    acampvmkgwniltnsektkkaregvmefllanhpldcpicdqggecdlqdqsmmfgsdr
    srflegkravedknigplvktimtrciqctrcirfaseiagvddlgttgrgndmqvgtyi
    ekmfmselsgniidicpvgaltxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
    xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
    xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
    xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
    xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
    xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
    xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
    xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
    xxxxxxxxxxxxxxxxxxxxxxxxx
    

  • Chain 'H':
    Sequence, based on SEQRES records:
    >5ldxH (H:)
    mfminilmliipillavafltlverkvlgymqlrkgpnvvgpygllqpiadaiklfikep
    lrpatssasmfilapimalglaltmwiplpmpyplinmnlgvlfmlamsslavysilwsg
    wasnskyaligalravaqtisyevtlaiillsvllmsgsftlstlittqeqmwlilpawp
    lammwfistlaetnrapfdltegeselvsgfnveyaagpfalffmaeyaniimmniftai
    lflgtshnphmpelytinftiksllltmsflwirasyprfrydqlmhllwknflpltlal
    cmwhvslpiltsgippqt
    

    Sequence, based on observed residues (ATOM records):
    >5ldxH (H:)
    minilmliipillavafltlverkvlgymqlrkgpnvvgpygllqpiadaiklfikeplr
    patssasmfilapimalglaltmwiplpmpyplinmnlgvlfmlamsslavysilwsgwa
    snskyaligalravaqtisyevtlaiillsvllmsgsftlstlittqeqmwlilpawpla
    mmwfistlaetnrapfdlgpfalffmaeyaniimmniftailflgtshnphmpelytinf
    tiksllltmsflwirasyprfrydqlmhllwknflpltlalcmwhvslpiltsgip
    

  • Chain 'I':
    Sequence; same for both SEQRES and ATOM records:
    >5ldxI (I:)
    tykyvnlrepsmdmksvtdraaqtllwtelirglgmtlsylfrepatinypfekgplspr
    frgehalrrypsgeerciacklceavcpaqaitieaepradgsrrttrydidmtkciycg
    fcqeacpvdaivegpnfefstetheellynkekllnngdkweaeiaaniqadylyr
    

  • Chain 'J':
    Sequence, based on SEQRES records:
    >5ldxJ (J:)
    mmlyivfilsvifvmgfvgfsskpspiygglglivsggvgcgivlnfggsflglmvfliy
    lggmmvvfgyttamateqypeiwlsnkavlgafvtgllmeffmvyyvlkdkevevvfefn
    glgdwviydtgdsgffseeamgiaalysygtwlvivtgwslligvvvimeitrgn
    

    Sequence, based on observed residues (ATOM records):
    >5ldxJ (J:)
    mlyivfilsvifvmgfvgfsskpspiygglglivsggvgcgivlnfggsflglmvfliyl
    ggmmvvfgyttamateqypeiwlsnkavlgafvtgllmeffmvyyvlkdkevevvfefng
    lgdwviydtgdsgffseeamgiaalysygtwlvivtgwslligvvvimeit
    

  • Chain 'K':
    Sequence, based on SEQRES records:
    >5ldxK (K:)
    msmvymnimmaftvslvgllmyrshlmssllclegmmlslfvmaaltilnshftlasmmp
    iillvfaaceaalglsllvmvsntygtdyvqnlnllqc
    

    Sequence, based on observed residues (ATOM records):
    >5ldxK (K:)
    smvymnimmaftvslvgllmyrshlmssllclegmmlslfvmaaltilnshftlasmmpi
    illvfaaceaalglsllvmvsntygtdyvqnlnll
    

  • Chain 'L':
    Sequence, based on SEQRES records:
    >5ldxL (L:)
    mnmfsslslvtlllltmpimmmsfntykpsnyplyvktaisyafitsmiptmmfihsgqe
    liisnwhwltiqtlklslsfkmdyfsmmfipvalfvtwsimefsmwymysdpninkffky
    lllflitmlilvtannlfqlfigwegvgimsflligwwygradantaalqailynrigdi
    gfilamawfltnlntwdlqqifmlnpsdsnmpliglalaatgksaqfglhpwlpsamegp
    tpvsallhsstmvvagifllirfypltennkyiqsitlclgaittlftamcaltqndikk
    iiafstssqlglmmvtiginqpylaflhicthaffkamlfmcsgsiihslndeqdirkmg
    glfkampftttalivgslaltgmpfltgfyskdliieaantsytnawallmtliatsfta
    iystriiffallgqprfptlvninennpllinsikrlligslfagyiisnnippttipqm
    tmpyylkttalivtilgfilaleisnmtknlkyhypsnafkfstllgyfptimhrlapym
    nlsmsqksasslldliwleailpktislaqmkastlvtnqkgliklyflsflitilismi
    lfnfhe
    

    Sequence, based on observed residues (ATOM records):
    >5ldxL (L:)
    nmfsslslvtlllltmpimmmsfntykpsnyplyvktaisyafitsmiptmmfihsgqel
    iisnwhwltiqtlklslsfkmdyfsmmfipvalfvtwsimefsmwymysdpninkffkyl
    llflitmlilvtannlfqlfigwegvgimsflligwwygradantaalqailynrigdig
    filamawfltnlntwdlqqifmlnpsdsnmpliglalaatgksaqfglhpwlpsamegpt
    pvsallhsstmvvagifllirfypltennkyiqsitlclgaittlftamcaltqndikki
    iafstssqlglmmvtiginqpylaflhicthaffkamlfmcsgsiihslndeqdirkmgg
    lfkampftttalivgslaltgmpfltgfyskdliieaantsytnawallmtliatsftai
    ystriiffallgqprfptlvninennpllinsikrlligslfagyiisnnippttipqmt
    mpyylkttalivtilgfilaleisnmtknlkyhypsnafkfstllgyfptimhrlapymn
    lsmsqksasslldliwleailpktislaqmkastlvtnqkgliklyflsflitilismil
    fnfh
    

  • Chain 'M':
    Sequence, based on SEQRES records:
    >5ldxM (M:)
    mlkyiiptimlmpltwlsknnmiwvnstahsllisftslllmnqfgdnslnfsllffsds
    lstplliltmwllplmlmasqhhlskenltrkklfitmlislqlflimtftamelilfyi
    lfeatlvptliiitrwgnqterlnaglyflfytlagslpllvaliyiqntvgslnflmlq
    ywvqpvhnswsnvfmwlacmmafmvkmplyglhlwlpkahveapiagsmvlaavllklgg
    ygmlritlilnpmtdfmaypfimlslwgmimtssiclrqtdlksliayssvshmalviva
    iliqtpwsymgatalmiahgltssmlfclansnyerihsrtmilarglqtllplmatwwl
    lasltnlalpptinligelfvvmstfswsnitiilmgvnmvitalyslymlimtqrgkyt
    yhinnispsftrenalmslhilplllltlnpkiilgply
    

    Sequence, based on observed residues (ATOM records):
    >5ldxM (M:)
    kyiiptimlmpltwlsknnmiwvnstahsllisftslllmnqfgdnslnfsllffsdsls
    tplliltmwllplmlmasqhhlskenltrkklfitmlislqlflimtftamelilfyilf
    eatlvptliiitrwgnqterlnaglyflfytlagslpllvaliyiqntvgslnflmlqyw
    vqpvhnswsnvfmwlacmmafmvkmplyglhlwlpkahveapiagsmvlaavllklggyg
    mlritlilnpmtdfmaypfimlslwgmimtssiclrqtdlksliayssvshmalvivail
    iqtpwsymgatalmiahgltssmlfclansnyerihsrtmilarglqtllplmatwwlla
    sltnlalpptinligelfvvmstfswsnitiilmgvnmvitalyslymlimtqrgkytyh
    innispsftrenalmslhilplllltlnpkiilgply
    

  • Chain 'N':
    Sequence, based on SEQRES records:
    >5ldxN (N:)
    mnpiifiiilltimlgtiivmisshwllvwigfemnmlaiipimmknhnprateastkyf
    ltqstasmllmmaviinlmfsgqwtvmklfnpmasmlmtmalamklgmapfhfwvpevtq
    giplssglilltwqklapmsvlyqifpsinlnliltlsvlsiliggwgglnqtqlrkima
    yssiahmgwmtavlpynptmtllnliiyiimtstmftmfmansttttlslshtwnktpim
    tvlilatllsmgglpplsgfmpkwmiiqemtknnsiilptfmaitallnlyfymrltyst
    tltmfpstnnmkmkwqfplmkkmtflptmvvlstmmlpltpmlsvle
    

    Sequence, based on observed residues (ATOM records):
    >5ldxN (N:)
    npiifiiilltimlgtiivmisshwllvwigfemnmlaiipimmknhnprateastkyfl
    tqstasmllmmaviinlmfsgqwtvmklfnpmasmlmtmalamklgmapfhfwvpevtqg
    iplssglilltwqklapmsvlyqifpsinlnliltlsvlsiliggwgglnqtqlrkimay
    ssiahmgwmtavlpynptmtllnliiyiimtstmftmfmansttttlslshtwnktpimt
    vlilatllsmgglpplsgfmpkwmiiqemtknnsiilptfmaitallnlyfymrltystt
    ltmfpstnnmkmkwqfplmkkmtflptmvvlstmmlpltpmlsv
    

  • Chain 'O':
    Sequence; same for both SEQRES and ATOM records:
    >5ldxO (O:)
    xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
    xxxxxxxxxxxxxxxxxxxxxxxxxxgnsyrlqawlyasrllqyadalehllstgqgvvl
    ersiysdfvfleamyrqgfirkqcvdhynqvkkvticeylpphvvvyvdvpvpevqsriq
    kkgnphemkitsaylqdienaykgtflpemsekcevlqysaweaqdaekvvedieylkyd
    kgpwldqndrnlhklrmlvqdklevlnytsipvflpevtvgahqsdqvfqeftelpgrky
    ragynedvgdkwiw
    

  • Chain 'P':
    Sequence; same for both SEQRES and ATOM records:
    >5ldxP (P:)
    xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
    xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
    xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
    xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
    xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
    

  • Chain 'Q':
    Sequence; same for both SEQRES and ATOM records:
    >5ldxQ (Q:)
    xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
    xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
    

  • Chain 'R':
    Sequence; same for both SEQRES and ATOM records:
    >5ldxR (R:)
    xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxcdgggg
    alghprvyinldketktgtcgycglqfrq
    

  • Chain 'S':
    Sequence, based on SEQRES records:
    >5ldxS (S:)
    maaaaairgvrgklglreirihlcqrspgsqgvrdfiekryvelkkanpdlpilirecsd
    vqpklwaryafgqeknvslnnfsadqvtralenvlsska
    

    Sequence, based on observed residues (ATOM records):
    >5ldxS (S:)
    reirihlcqrspgsqgvrdfiekryvelkkanpdlpilirecsdvqpklwaryafgqekn
    vslnnfsadqvtralenvls
    

  • Chain 'T':
    Sequence, based on SEQRES records:
    >5ldxT (T:)
    sdappltlegikdrvlyvlklydkidpeklsvnshfmkdlgldsldqveiimamedefgf
    eipdidaeklmcpqeivdyiadkkdvye
    

    Sequence, based on observed residues (ATOM records):
    >5ldxT (T:)
    legikdrvlyvlklydkidpeklsvnshfmkdlgldsldqveiimamedefgfeipdida
    eklmcpqeivdyiad
    

  • Chain 'U':
    Sequence, based on SEQRES records:
    >5ldxU (U:)
    sdappltlegikdrvlyvlklydkidpeklsvnshfmkdlgldsldqveiimamedefgf
    eipdidaeklmcpqeivdyiadkkdvye
    

    Sequence, based on observed residues (ATOM records):
    >5ldxU (U:)
    ppltlegikdrvlyvlklydkidpeklsvnshfmkdlgldsldqveiimamedefgfeip
    didaeklmcpqeivdyiadkkdvye
    

  • Chain 'V':
    Sequence, based on SEQRES records:
    >5ldxV (V:)
    agllkkttglvglavcetpherlkilytkildvlghipknaayrkyteqitneklsmvka
    epdvkkleerlqggqieevilqaenelslarkmiqwkpweplveeppasqwkwpi
    

    Sequence, based on observed residues (ATOM records):
    >5ldxV (V:)
    tglvglavcetpherlkilytkildvlghipknaayrkyteqitneklsmvkaepdvkkl
    eerlqggqieevilqaenelslarkmiqwkpweplveeppasqwkw
    

  • Chain 'W':
    Sequence, based on SEQRES records:
    >5ldxW (W:)
    aasglrqaavaastsvkpifsrdmneakrrvrelyrawyrevpntvhlfqldisvkqgrd
    kvremfkknahitdprvvdllvikgkmeleetikvwkqrthvmrffheteaprpkdflsk
    fyvghdp
    

    Sequence, based on observed residues (ATOM records):
    >5ldxW (W:)
    vkpifsrdmneakrrvrelyrawyrevpntvhlfqldisvkqgrdkvremfkknahitdp
    rvvdllvikgkmeleetikvwkqrthvmrffheteaprpkdflskfyvghd
    

  • Chain 'X':
    Sequence; same for both SEQRES and ATOM records:
    >5ldxX (X:)
    elpsledlkvqevkvsssvlkaaahhygaqcdkpnkefmlcrweekdprrcleegklvnq
    caleffrqikrhcaepfteywtcidysglqlfrrcrkqqaqfdecvldkxxxxxxxxxxx
    xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
    

  • Chain 'Y':
    Sequence, based on SEQRES records:
    >5ldxY (Y:)
    aktvlrqywdipegtechrktyattsiggaaglvvsaysvalktptsflegvartgrytf
    taaaigaifgltscisaqvrekpddplnyliggcagglilgartrsygigaaacaymglt
    aalvkmgqlegwqvfaepkv
    

    Sequence, based on observed residues (ATOM records):
    >5ldxY (Y:)
    aktvlrqywdipegtechrktyattsiggaaglvvsaysvalktptsflegvartgrytf
    taaaigaifgltscisaqvrekpddplnyliggcagglilgartrsygigaaacaymglt
    aalvkmgqlegwqvfaep
    

  • Chain 'Z':
    Sequence; same for both SEQRES and ATOM records:
    >5ldxZ (Z:)
    xxxxxxxxxxxxxxxxxxxxxxxxxxgysmfavgigallfgywsmmkwnrerrrlqiedf
    earialmpllqaekdrrvlqmlrenleeeatvmkdxxxxxxxxxxxxxxxxxxxxxxxxx
    xxxxxxxxxxxxxxxxxx
    

  • Chain 'a':
    Sequence, based on SEQRES records:
    >5ldxa (a:)
    mwfevlpgiavmgvclfipgmatarihrfsnggkekrvahypyqwylmerdrrvsgvnrs
    yvskglenid
    

    Sequence, based on observed residues (ATOM records):
    >5ldxa (a:)
    mwfevlpgiavmgvclfipgmatarihrfsnggkekrvahypyqwylmerdrrvsgvnrs
    yvsk
    

  • Chain 'b':
    Sequence; same for both SEQRES and ATOM records:
    >5ldxb (b:)
    aervaaflknvwakepvlvasfaiaglavilptlspytkyslminxxxxxxxxxxxxxxx
    xxxxxxxxxxxxxxxxxxxx
    

  • Chain 'c':
    Sequence, based on SEQRES records:
    >5ldxc (c:)
    kfyiqepphgspnwlkvgltlgtsvflwiylikqhnedvleykrrngle
    

    Sequence, based on observed residues (ATOM records):
    >5ldxc (c:)
    kfyiqepphgspnwlkvgltlgtsvflwiylikqhnedvleykrrn
    

  • Chain 'd':
    Sequence; same for both SEQRES and ATOM records:
    >5ldxd (d:)
    xxxxxxxxxxxxxxxxxxxxxxxxxxprlafvgflgycsglidnairrrpvllaglhrql
    lyitsfvfvgyyllkrqdymyavrdhdmfsyikshxxxxxxxxxxxxxxxxxxx
    

  • Chain 'e':
    Sequence, based on SEQRES records:
    >5ldxe (e:)
    mpffdvqkrlgvdldrwmtiqsaeqphkipsrchafekewiecahgigsiraekeckief
    edfrecllrqktmkrlhairrqreklikegkytppphhsgqeeprs
    

    Sequence, based on observed residues (ATOM records):
    >5ldxe (e:)
    qkrlgvdldrwmtiqsaeqphkipsrchafekewiecahgigsiraekeckiefedfrec
    llrqktmkrlhairrqreklikegkytpp
    

  • Chain 'f':
    Sequence, based on SEQRES records:
    >5ldxf (f:)
    mnllqvvrdhwvhvlvpmgfvfgyyldrkndekltafrnksllykrelkpneevtwk
    

    Sequence, based on observed residues (ATOM records):
    >5ldxf (f:)
    llqvvrdhwvhvlvpmgfvfgyyldrkndekltafrnksllykrelkpneevtw
    

  • Chain 'g':
    Sequence, based on SEQRES records:
    >5ldxg (g:)
    essssraviapstlagkrpseptlrwqedpepedenlyeknpdshgydkdpavdiwnmrv
    vfffgfsivlvlgstfvaylpdyrmqewarreaerlvkyreahglpimesncfdpskiql
    peded
    

    Sequence, based on observed residues (ATOM records):
    >5ldxg (g:)
    rwqedpepedenlyeknpdshgydkdpavdiwnmrvvfffgfsivlvlgstfvaylpdyr
    mqewarreaerlvkyreahglpimesncfdpskiqlp
    

  • Chain 'h':
    Sequence; same for both SEQRES and ATOM records:
    >5ldxh (h:)
    rlfiikpsgfydkrflkllrfyilltgipvaigitlinvxxxxxxxxxxxxxxxxxxxxx
    xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
    xxxxxxxxxxxxxx
    

  • Chain 'i':
    Sequence; same for both SEQRES and ATOM records:
    >5ldxi (i:)
    eeklrlqqlrelrrrwlkdqelsprepxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
    xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
    

  • Chain 'j':
    Sequence; same for both SEQRES and ATOM records:
    >5ldxj (j:)
    xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
    

  • Chain 'k':
    Sequence; same for both SEQRES and ATOM records:
    >5ldxk (k:)
    xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
    xxxxxxxxxxxxxx
    

  • Chain 'l':
    Sequence; same for both SEQRES and ATOM records:
    >5ldxl (l:)
    xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
    xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
    

  • Chain 'm':
    Sequence; same for both SEQRES and ATOM records:
    >5ldxm (m:)
    xxxxxxxxxxxxxxxxxxxxxqaerlairsrlkreyqlqyydpsrrgviedpalvrwtya
    rsaniypnfrpntktsllgalfgigplvfwyyvfktdrdrkekliqegkldrtfnisy
    

  • Chain 'n':
    Sequence; same for both SEQRES and ATOM records:
    >5ldxn (n:)
    thqqkvlrlykralrhleswcihrdkyryfacllrarfdehknekdmvkatqllreaeee
    fwhgqhpqpyifpespggtsyeryecykvpewclddwhpsekamypdyfakreqwkklrr
    eswerevxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
    

  • Chain 'o':
    Sequence; same for both SEQRES and ATOM records:
    >5ldxo (o:)
    ycahylirflkckrdsfpnflackherhdwdycehldyvkrmkefererrllqrkkrr
    

  • Chain 'p':
    Sequence; same for both SEQRES and ATOM records:
    >5ldxp (p:)
    xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
    xxxxxxxxxxxxcqekdvlcmfeaemqwrrdykvdqeivniiqerlkacqqregeshrqn
    cakeleqftqvvkayqdryxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
    

  • Chain 'q':
    Sequence; same for both SEQRES and ATOM records:
    >5ldxq (q:)
    ellqvlkrglqqvsghgglrgylrvlfrandvrvgtlvgedkygnkyyednkqffgrhrw
    viyttemngkntfwdvdgsmvppewhrwlhcmtddpptvkpptarkfiwtnhkfnlsgtp
    qqyvpysttrkkiqewvp
    

  • Chain 'r':
    Sequence; same for both SEQRES and ATOM records:
    >5ldxr (r:)
    xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
    xxxxxxxxxxxxxxxxxxxxxxxxxxx
    

  • Chain 's':
    Sequence; same for both SEQRES and ATOM records:
    >5ldxs (s:)
    xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx