PDB entry 5ldn

View 5ldn on RCSB PDB site
Description: A viral capsid:antibody complex
Class: viral protein
Keywords: TRIM21, 9C12, Adenovirus, neutralization, viral protein
Deposited on 2016-06-27, released 2017-07-12
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-12-19, with a file datestamp of 2018-12-14.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: N/A
AEROSPACI score: 0.17 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hexon protein,hexon capsid
    Species: Human adenovirus 5 [TaxId:28285]
    Gene: L3
    Database cross-references and differences (RAF-indexed):
    • Uniprot P04133 (0-926)
      • linker (139-142)
    • PDB 5LDN (143-926)
    Domains in SCOPe 2.08: d5ldna1, d5ldna2
  • Chain 'H':
    Compound: antibody
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 5LDN (0-217)
    Domains in SCOPe 2.08: d5ldnh_
  • Chain 'L':
    Compound: antibody
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 5LDN (0-212)
    Domains in SCOPe 2.08: d5ldnl1, d5ldnl2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5ldnA (A:)
    pqwsymhisgqdaseylspglvqfaratetyfslnnkfrnptvapthdvttdrsqrltlr
    fipvdredtaysykarftlavgdnrvldmastyfdirgvldrgptfkpysgtaynalapk
    gapnpcewdeaataleinlaqaeqkthvfgqapysginitkegiqigvegqtpkyadktf
    qpepqigesqwyeteinhaagrvlkkttpmkpcygsyakptnenggqgilvkqqngkles
    qvemqffstteatagngdnltpkvvlysedvdietpdthisymptikegnsrelmgqqsm
    pnrpnyiafrdnfiglmyynstgnmgvlagqasqlnavvdlqdrntelsyqllldsigdr
    tryfsmwnqavdsydpdvriienhgtedelpnycfplggvintetltkvkpktgqengwe
    kdatefsdkneirvgnnfameinlnanlwrnflysnialylpdklkyspsnvkisdnpnt
    ydymnkrvvapglvdcyinlgarwsldymdnvnpfnhhrnaglryrsmllgngryvpfhi
    qvpqkffaiknllllpgsytyewnfrkdvnmvlqsslgndlrvdgasikfdsiclyatff
    pmahntastleamlrndtndqsfndylsaanmlypipanatnvpisipsrnwaafrgwaf
    trlktketpslgsgydpyytysgsipyldgtfylnhtfkkvaitfdssvswpgndrlltp
    nefeikrsvdgegynvaqcnmtkdwflvqmlanynigyqgfyipesykdrmysffrnfqp
    msrqvvddtkykdyqqvgilhqhnnsgfvgylaptmregqaypanfpypligktavdsit
    qkkflcdrtlwripfssnfmsmgaltdlgqnllyansahaldmtfevdpmdeptllyvlf
    evfdvvrvhrphrgvietvylrtpfsa
    

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5ldnH (H:)
    vqlkqsgpgllqpsqrlsitctvsgfslgrygvhwirqspgkglewlgviwrggttdyna
    vfmsrlsinkddsksqvfftmnslrpddtaiyycarqgsnfplaywgqgtlvtvsaaktt
    ppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsdlytl
    sssvtvpsstwpsqtvtcnvahpasstkvdkkivprdc
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5ldnL (L:)
    nivmtqtpkfllvsigdsititckasqsvtndaawyqkkpgqspqlliyqastrytgvpd
    rfsgsgygtdftftisavqaedlavyfchqdysspltfgagtklelkradaaptvsifpp
    sseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstlt
    ltkdeyerhnsytceathktstspivksfnrne