PDB entry 5ldk

View 5ldk on RCSB PDB site
Description: Crystal structure of E.coli LigT complexed with ATP
Class: hydrolase
Keywords: Enzyme, 2H phosphoesterase/ligase, hydrolase
Deposited on 2016-06-27, released 2017-01-18
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-02-08, with a file datestamp of 2017-02-03.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: N/A
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: RNA 2',3'-cyclic phosphodiesterase
    Species: Escherichia coli (strain B / BL21-DE3) [TaxId:469008]
    Gene: thpR, ECBD_3472
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5ldka_
  • Chain 'B':
    Compound: RNA 2',3'-cyclic phosphodiesterase
    Species: Escherichia coli (strain B / BL21-DE3) [TaxId:469008]
    Gene: thpR, ECBD_3472
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5ldkb_
  • Heterogens: ATP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5ldkA (A:)
    gmsepqrlffaidlpaeireqiihwrakhfppeagrpvaadnlhltlaflgevsaekeka
    lsllagrirqpgftltlddagqwlrsrvvwlgmrqpprgliqlanmlrsqaarsgcfqsn
    rpfhphitllrdaseavtipppgfnwsyavteftlyassfargrtrytplkrwaltq
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ldkA (A:)
    sepqrlffaidlpaeireqiihwrakhfppeagrpvaadnlhltlaflgevsaekekals
    llagrirqpgftltlddagqwlrsrvvwlgmrqpprgliqlanmlrsqarpfhphitllr
    daseavtipppgfnwsyavteftlyassfargrtrytplkrwaltq
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5ldkB (B:)
    gmsepqrlffaidlpaeireqiihwrakhfppeagrpvaadnlhltlaflgevsaekeka
    lsllagrirqpgftltlddagqwlrsrvvwlgmrqpprgliqlanmlrsqaarsgcfqsn
    rpfhphitllrdaseavtipppgfnwsyavteftlyassfargrtrytplkrwaltq
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ldkB (B:)
    sepqrlffaidlpaeireqiihwrakhfppeagrpvaadnlhltlaflgevsaekekals
    llagrirqpgftltlddagqwlrsrvvwlgmrqpprgliqlanmlrsqaarsgcfrpfhp
    hitllrdaseavtipppgfnwsyavteftlyassfargrtrytplkrwaltq