PDB entry 5ldg

View 5ldg on RCSB PDB site
Description: Isopiperitenone reductase from Mentha piperita in complex with Isopiperitenone and NADP
Class: oxidoreductase
Keywords: short-chain dehydrogenases/reductases (SDR), Rossmann fold, Isopiperitenone, Isopulegone, oxidoreductase
Deposited on 2016-06-26, released 2016-08-31
The last revision prior to the SCOPe 2.06 freeze date was dated 2016-08-31, with a file datestamp of 2016-08-24.
Experiment type: XRAY
Resolution: 1.3 Å
R-factor: N/A
AEROSPACI score: 0.59 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: (-)-isopiperitenone reductase
    Species: Mentha piperita [TaxId:34256]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5ldga_
  • Heterogens: NAP, IT9, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5ldgA (A:)
    gamaevqryalvtgankgigfeicrqlaekgiiviltsrnekrglearqkllkelnvsen
    rlvfhqldvtdlasvaavavfikskfgkldilvnnagvsgvemvgdvsvfneyieadfka
    lqaleagakeeppfkpkangemiekfegakdcvvtnyygpkrltqalipllqlspspriv
    nvsssfgsllllwnewakgvlgdedrlteervdevvevflkdikegkleesqwpphfaae
    rvskaalnaytkiaakkypsfrinaicpgyaktditfhagplsvaeaaqvpvklallpdg
    gpsgcffprdkalaly
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ldgA (A:)
    qryalvtgankgigfeicrqlaekgiiviltsrnekrglearqkllkelnvsenrlvfhq
    ldvtdlasvaavavfikskfgkldilvnnagvsgvemvgdvsvfneyieadfkalqalea
    gakeeppfkpkangemiekfegakdcvvtnyygpkrltqalipllqlspsprivnvsssf
    gsllllwnewakgvlgdedrlteervdevvevflkdikegkleesqwpphfaaervskaa
    lnaytkiaakkypsfrinaicpgyaktditfhagplsvaeaaqvpvklallpdggpsgcf
    fprdkalaly