PDB entry 5lda

View 5lda on RCSB PDB site
Description: Structure of deubiquitinating enzyme homolog (Pyrococcus furiosus JAMM1) in complex with ubiquitin-like SAMP2.
Class: cell cycle
Keywords: JAMM/MPN+, metalloprotease, deubiquitination, ubiquitin-like protein, cell cycle
Deposited on 2016-06-24, released 2017-06-21
The last revision prior to the SCOPe 2.06 freeze date was dated 2017-06-21, with a file datestamp of 2017-06-16.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: N/A
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: jamm1
    Species: Pyrococcus furiosus [TaxId:186497]
    Gene: PF1070
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8U1Y4 (1-129)
      • initiating methionine (0)
  • Chain 'B':
    Compound: samp2
    Species: Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) [TaxId:186497]
    Gene: PF1061
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5ldab_
  • Heterogens: ZN, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5ldaB (B:)
    mkmikvkvigrniekeiewregmkvrdilravgfntesaiakvngkvvleddevkdgdfv
    evipvvsgg
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ldaB (B:)
    kvkvigrniemkvrdilravgfntesaiakvngkvvleddevkdgdfvevipvvsgg