PDB entry 5ld9

View 5ld9 on RCSB PDB site
Description: structure of deubiquitinating enzyme homolog, pyrococcus furiosus jamm1.
Deposited on 2016-06-24, released 2017-05-17
The last revision was dated 2017-08-30, with a file datestamp of 2017-08-25.
Experiment type: XRAY
Resolution: 1.73 Å
R-factor: N/A
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: jamm1
    Species: Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) [TaxId:186497]
    Gene: PF1070
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: jamm1
    Species: Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) [TaxId:186497]
    Gene: PF1070
    Database cross-references and differences (RAF-indexed):
  • Heterogens: ZN, CL, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >5ld9A (A:)
    mpsssksdfsfstliipqhylrailkvvssssvevcgflfgkenrvlkvrfirnrlnspv
    efemdpeemlkaleeaeqenlevvgifhshiacppipsgkdlegmkrwpviwlivnekge
    ykawilseknkisevkivve
    

    Sequence, based on observed residues (ATOM records):
    >5ld9A (A:)
    stliipqhylrailkvvssssvevcgflfgkenrvlkvrfirnrlnspvefemdpeemlk
    aleeaeqenlevvgifhshiacppipsgkdlegmkrwpviwlivnekgeykawilseknk
    isevkivve
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >5ld9B (B:)
    mpsssksdfsfstliipqhylrailkvvssssvevcgflfgkenrvlkvrfirnrlnspv
    efemdpeemlkaleeaeqenlevvgifhshiacppipsgkdlegmkrwpviwlivnekge
    ykawilseknkisevkivve
    

    Sequence, based on observed residues (ATOM records):
    >5ld9B (B:)
    stliipqhylrailkvvssssvevcgflfgkenrvlkvrfirnrlnspvefemdpeemlk
    aleeaeqenlevvgifhshiacppipsgkdlegmkrwpviwlivnekgeykawilnkise
    vkivve