PDB entry 5ld0

View 5ld0 on RCSB PDB site
Description: Chimeric GST
Class: transferase
Keywords: Directed evolution, Glutathione transferase A1-1, protein stability, transferase
Deposited on 2016-06-23, released 2016-09-21
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-12-21, with a file datestamp of 2016-12-16.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: N/A
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Glutathione S-transferase A1,Glutathione S-transferase alpha-2,Glutathione S-transferase A1
    Species: Homo sapiens [TaxId:9606]
    Gene: GSTA1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5ld0a1, d5ld0a2
  • Heterogens: CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5ld0A (A:)
    maekpklhyfnargrmestrwllaaagvefeekfiksaedldklrndgylmfqqvpmvei
    dgmklvqtrailnyiaskynlygkdmkeralidmysegildltemiiqlvicppdqreak
    talakdrtknrylpafekvlkshgqdylvgnrltrvdihllelllyveefdaslltsfpl
    lkafksrisslpnvkkflqpgsqrkpamdakqieearkifrf
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ld0A (A:)
    aekpklhyfnargrmestrwllaaagvefeekfiksaedldklrndgylmfqqvpmveid
    gmklvqtrailnyiaskynlygkdmkeralidmysegildltemiiqlvicppdqreakt
    alakdrtknrylpafekvlkshgqdylvgnrltrvdihllelllyveefdaslltsfpll
    kafksrisslpnvkkflqpgsqrkpa