PDB entry 5lcz

View 5lcz on RCSB PDB site
Description: Chimeric GST
Class: transferase
Keywords: Directed evolution, Glutathione transferase A1-1, protein stability, transferase
Deposited on 2016-06-23, released 2016-09-21
The last revision prior to the SCOPe 2.06 freeze date was dated 2016-09-21, with a file datestamp of 2016-09-16.
Experiment type: XRAY
Resolution: 2.33 Å
R-factor: N/A
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Glutathione S-transferase A1,Glutathione S-transferase alpha-2,Glutathione S-transferase A1,Glutathione S-transferase alpha-2,Glutathione S-transferase A1
    Species: Homo sapiens [TaxId:9606]
    Gene: GSTA1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5lcza1, d5lcza2
  • Chain 'B':
    Compound: Glutathione S-transferase A1,Glutathione S-transferase alpha-2,Glutathione S-transferase A1,Glutathione S-transferase alpha-2,Glutathione S-transferase A1
    Species: Homo sapiens [TaxId:9606]
    Gene: GSTA1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5lczb1, d5lczb2
  • Heterogens: GSH, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5lczA (A:)
    maekpklhyfnargrmestrwllaaagvefeekfiksaedldklrndgylmfqqvpmvei
    dgmklvqtrailnyiaskynlygkdmkeralidmysegildltemiiqlvicppdqreak
    talakdrtknrylpafekvlkshgqdylvgnrltrvdihllelllyveefdaslltsfpl
    lkafksrisslpnvkkflqpgsqrkpamdakqieearkifrf
    

    Sequence, based on observed residues (ATOM records): (download)
    >5lczA (A:)
    aekpklhyfnargrmestrwllaaagvefeekfiksaedldklrndgylmfqqvpmveid
    gmklvqtrailnyiaskynlygkdmkeralidmysegildltemitalakdrtknrylpa
    fekvlkshgqdylvgnrltrvdihllelllyveefdaslltsfpllkafksrisslpnvk
    kflqpgsqrkpamda
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5lczB (B:)
    maekpklhyfnargrmestrwllaaagvefeekfiksaedldklrndgylmfqqvpmvei
    dgmklvqtrailnyiaskynlygkdmkeralidmysegildltemiiqlvicppdqreak
    talakdrtknrylpafekvlkshgqdylvgnrltrvdihllelllyveefdaslltsfpl
    lkafksrisslpnvkkflqpgsqrkpamdakqieearkifrf
    

    Sequence, based on observed residues (ATOM records): (download)
    >5lczB (B:)
    aekpklhyfnargrmestrwllaaagvefeekfiksaedldklrndgylmfqqvpmveid
    gmklvqtrailnyiaskynlygkdmkeralidmysegildltemiiqlvicppdqreakt
    alakdrtknrylpafekvlkshgqdylvgnrltrvdihllelllyveefdaslltsfpll
    kafksrisslpnvkkflqpgsqrkpamda