PDB entry 5lcy

View 5lcy on RCSB PDB site
Description: formaldehyde-responsive regulator frmr e64h variant from salmonella enterica serovar typhimurium
Deposited on 2016-06-22, released 2016-08-10
The last revision was dated 2017-08-30, with a file datestamp of 2017-08-25.
Experiment type: XRAY
Resolution: 2.19 Å
R-factor: N/A
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Frmr
    Species: Salmonella enterica serovar Typhimurium [TaxId:90371]
    Gene: SL1344_1558
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Frmr
    Species: Salmonella enterica serovar Typhimurium [TaxId:90371]
    Gene: SL1344_1558
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: Frmr
    Species: Salmonella enterica serovar Typhimurium [TaxId:90371]
    Gene: SL1344_1558
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: Frmr
    Species: Salmonella enterica serovar Typhimurium [TaxId:90371]
    Gene: SL1344_1558
    Database cross-references and differences (RAF-indexed):
  • Heterogens: HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >5lcyA (A:)
    mphspedkkriltrvrrirgqvealeralesgepclailqqiaavrgasnglmsemveih
    lkdhlvsgettpdqravrmaeighllraylk
    

    Sequence, based on observed residues (ATOM records):
    >5lcyA (A:)
    phspedkkriltrvrrirgqvealeralesgepclailqqiaavrgasnglmsemveihl
    kdhlvsgettpdqravrmaeighllray
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >5lcyB (B:)
    mphspedkkriltrvrrirgqvealeralesgepclailqqiaavrgasnglmsemveih
    lkdhlvsgettpdqravrmaeighllraylk
    

    Sequence, based on observed residues (ATOM records):
    >5lcyB (B:)
    phspedkkriltrvrrirgqvealeralesgepclailqqiaavrgasnglmsemveihl
    kdhlvsgettpdqravrmaeighllrayl
    

  • Chain 'C':
    Sequence, based on SEQRES records:
    >5lcyC (C:)
    mphspedkkriltrvrrirgqvealeralesgepclailqqiaavrgasnglmsemveih
    lkdhlvsgettpdqravrmaeighllraylk
    

    Sequence, based on observed residues (ATOM records):
    >5lcyC (C:)
    phspedkkriltrvrrirgqvealeralesgepclailqqiaavrgasnglmsemveihl
    kdhlvsgettpdqravrmaeighllrayl
    

  • Chain 'D':
    Sequence, based on SEQRES records:
    >5lcyD (D:)
    mphspedkkriltrvrrirgqvealeralesgepclailqqiaavrgasnglmsemveih
    lkdhlvsgettpdqravrmaeighllraylk
    

    Sequence, based on observed residues (ATOM records):
    >5lcyD (D:)
    phspedkkriltrvrrirgqvealeralesgepclailqqiaavrgasnglmsemveihl
    kdhlvsgettpdqravrmaeighllray