PDB entry 5lcx

View 5lcx on RCSB PDB site
Description: Isopiperitenone reductase from Mentha piperita in complex with NADP
Class: oxidoreductase
Keywords: short-chain dehydrogenases/reductases (SDR), Rossmann fold, Isopiperitenone, Isopulegone, oxidoreductase
Deposited on 2016-06-22, released 2016-08-31
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-08-30, with a file datestamp of 2017-08-25.
Experiment type: XRAY
Resolution: 1.71 Å
R-factor: N/A
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: (-)-isopiperitenone reductase
    Species: Mentha piperita [TaxId:34256]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5lcxa_
  • Heterogens: NAP, MPD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5lcxA (A:)
    gamaevqryalvtgankgigfeicrqlaekgiiviltsrnekrglearqkllkelnvsen
    rlvfhqldvtdlasvaavavfikskfgkldilvnnagvsgvemvgdvsvfneyieadfka
    lqaleagakeeppfkpkangemiekfegakdcvvtnyygpkrltqalipllqlspspriv
    nvsssfgsllllwnewakgvlgdedrlteervdevvevflkdikegkleesqwpphfaae
    rvskaalnaytkiaakkypsfrinaicpgyaktditfhagplsvaeaaqvpvklallpdg
    gpsgcffprdkalaly
    

    Sequence, based on observed residues (ATOM records): (download)
    >5lcxA (A:)
    qryalvtgankgigfeicrqlaekgiiviltsrnekrglearqkllkelnvsenrlvfhq
    ldvtdlasvaavavfikskfgkldilvnnagvsgvemvgdvsvfneyieadfkalqalea
    gakeeppfkpkangemiekfegakdcvvtnyygpkrltqalipllqlspsprivnvsssf
    gsllllwnewakgvlgdedrlteervdevvevflkdikegkleesqwpphfaaervskaa
    lnaytkiaakkypsfrinaicpgyaktditfhagplsvaeaaqvpvklallpdggpsgcf
    fprdkalaly