PDB entry 5lcv

View 5lcv on RCSB PDB site
Description: Structural basis of Zika and Dengue virus potent antibody cross-neutralization
Class: viral protein/immune system
Keywords: Immune system-viral protein complex, zika virus, broadly neutralizing antibody, viral protein, immune system, VIRAL PROTEIN-IMMUNE SYSTEM complex
Deposited on 2016-06-22, released 2016-07-06
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-08-17, with a file datestamp of 2016-08-12.
Experiment type: XRAY
Resolution: 2.64 Å
R-factor: N/A
AEROSPACI score: 0.18 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Polyprotein
    Species: Zika virus [TaxId:64320]
    Database cross-references and differences (RAF-indexed):
    • Uniprot A0A120IIH9 (0-End)
      • expression tag (418-424)
  • Chain 'B':
    Compound: Polyprotein
    Species: Zika virus [TaxId:64320]
    Database cross-references and differences (RAF-indexed):
    • Uniprot A0A120IIH9 (0-End)
      • expression tag (418-422)
  • Chain 'H':
    Compound: broadly neutralizing human antibody ede2 a11
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 5LCV (0-End)
  • Chain 'L':
    Compound: broadly neutralizing human antibody ede2 a11
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 5LCV
    Domains in SCOPe 2.07: d5lcvl1, d5lcvl2
  • Heterogens: NAG, GOL, FMT, BMA, FUC, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    No sequence available.

  • Chain 'H':
    No sequence available.

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >5lcvL (L:)
    qsvltqpvsvsgspgqsitisctgtssnadtynlvswyqqrpgkapklmiyegtkrpsgv
    snrfsasksataasltisglqpedeadyyccsyatsrtlvfgggtkltvvgqpkaapsvt
    lfppsseelqankatlvclisdfypgavtvawkadsspvkagvetttpskqsnnkyaass
    ylsltpeqwkshrsyscqvthegstvektvaptecs
    

    Sequence, based on observed residues (ATOM records): (download)
    >5lcvL (L:)
    svltqpvsvsgspgqsitisctgtssnadtynlvswyqqrpgkapklmiyegtkrpsgvs
    nrfsasksataasltisglqpedeadyyccsyatsrtlvfgggtkltvvgqpkaapsvtl
    fppsseelqankatlvclisdfypgavtvawkadsspvkagvetttpskqsnnkyaassy
    lsltpeqwkshrsyscqvthegstvektvapt