PDB entry 5lct

View 5lct on RCSB PDB site
Description: cocrystal structure of camp-dependent protein kinase (pka) in complex with a r-methyl-piperazine substituted fasudil-derivative (ligand 02)
Deposited on 2016-06-22, released 2018-01-17
The last revision was dated 2018-01-17, with a file datestamp of 2018-01-12.
No data on structure quality are available

Chains and heterogens:

  • Chain 'A':
    Compound: cAMP-dependent protein kinase catalytic subunit alpha
    Species: Cricetulus griseus [TaxId:10029]
    Gene: PRKACA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P25321 (2-352)
      • expression tag (0-1)
  • Chain 'B':
    Compound: cAMP-dependent protein kinase inhibitor alpha
    Species: HOMO SAPIENS, synthetic [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
  • Heterogens: 6TY, MPD, MOH, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >5lctA (A:)
    ghmgnaaaakkgseqesvkeflakakeeflkkwespsqntaqldhfdriktlgtgsfgrv
    mlvkhketgnhyamkildkqkvvklkqiehtlnekrilqavnfpflvklefsfkdnsnly
    mvmeyvpggemfshlrrigrfsepharfyaaqivltfeylhsldliyrdlkpenllidqq
    gyiqvtdfgfakrvkgrtwtlcgtpeylapeiilskgynkavdwwalgvliyemaagypp
    ffadqpiqiyekivsgkvrfpshfssdlkdllrnllqvdltkrfgnlkngvndiknhkwf
    attdwiaiyqrkveapfipkfkgpgdtsnfddyeeeeirvsinekcgkeftef
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records:
    >5lctB (B:)
    ttyadfiasgrtgrrnaihd