PDB entry 5lci

View 5lci on RCSB PDB site
Description: solution structure of bola1 from homo sapiens
Deposited on 2016-06-21, released 2016-08-31
The last revision was dated 2019-10-30, with a file datestamp of 2019-10-25.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: BolA-like protein 1
    Species: Homo sapiens [TaxId:9606]
    Gene: BOLA1, CGI-143
    Database cross-references and differences (RAF-indexed):

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >5lciA (A:)
    gidpftqgsagsgaigpveaairtkleealspevlelrnesgghavppgsethfrvavvs
    srfeglsplqrhrlvhaalaeelggpvhalaiqartpaqwrensqldtsppclggnkktl
    gtp
    

    Sequence, based on observed residues (ATOM records):
    >5lciA (A:)
    pveaairtkleealspevlelrnesgghavppgsethfrvavvssrfeglsplqrhrlvh
    aalaeelggpvhalaiqartpaqwrens