PDB entry 5lc7

View 5lc7 on RCSB PDB site
Description: Crystal structure of a single chain monellin mutant: E23Q/Q28K/C41S/Y65R-MNEI
Class: plant protein
Keywords: plant protein, sweet protein
Deposited on 2016-06-19, released 2016-10-05
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-10-05, with a file datestamp of 2016-09-30.
Experiment type: XRAY
Resolution: 1.55 Å
R-factor: N/A
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Monellin chain B,Monellin chain A
    Species: Dioscoreophyllum cumminsii [TaxId:3457]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02882 (1-End)
      • engineered mutation (23)
      • engineered mutation (28)
      • engineered mutation (41)
    • Uniprot P02881 (Start-96)
      • engineered mutation (65)
    Domains in SCOPe 2.07: d5lc7a_
  • Chain 'B':
    Compound: Monellin chain B,Monellin chain A
    Species: Dioscoreophyllum cumminsii [TaxId:3457]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02882 (1-48)
      • initiating methionine (0)
      • engineered mutation (23)
      • engineered mutation (28)
      • engineered mutation (41)
      • linker (49-51)
    • Uniprot P02881 (52-96)
      • engineered mutation (65)
    Domains in SCOPe 2.07: d5lc7b_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5lc7A (A:)
    mgeweiidigpftqnlgkfavdeqnkigkygrltfnkvirpsmkktiyenegfreikgye
    yqlyvrasdklfradisedyktrgrkllrfngpvppp
    

    Sequence, based on observed residues (ATOM records): (download)
    >5lc7A (A:)
    geweiidigpftqnlgkfavdeqnkigkygrltfnkvirpsmkktikgyeyqlyvrasdk
    lfradisedyktrgrkllrfngpvppp
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5lc7B (B:)
    mgeweiidigpftqnlgkfavdeqnkigkygrltfnkvirpsmkktiyenegfreikgye
    yqlyvrasdklfradisedyktrgrkllrfngpvppp