PDB entry 5lc3

View 5lc3 on RCSB PDB site
Description: xray structure of mouse fam3c ilei monomer
Deposited on 2016-06-19, released 2017-08-02
The last revision was dated 2019-10-16, with a file datestamp of 2019-10-11.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Protein FAM3C
    Species: Mus musculus [TaxId:10090]
    Gene: Fam3c, D6Wsu176e, Ilei
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Protein FAM3C
    Species: Mus musculus [TaxId:10090]
    Gene: Fam3c, D6Wsu176e, Ilei
    Database cross-references and differences (RAF-indexed):
  • Heterogens: HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >5lc3A (A:)
    mplllllpllwagalaelhhhhhhenlyfqsgrykcgiskacpekhfafkmasgaanvvg
    pkiclednvlmsgvknnvgrginialvngktgevidtkffdmwggdvapfieflktiqdg
    tvvlmatyddgatkltdearrliaelgstsitslgfrdnwvfcggkgiktkspfeqhikn
    nketnkyegwpevvemegcipqkqd
    

    Sequence, based on observed residues (ATOM records):
    >5lc3A (A:)
    ykcgiskacpekhfafkmasgaanvvgpkiclednvlmsgvknnvgrginialvngktge
    vidtkffdmwggdvapfieflktiqdgtvvlmatyddgatkltdearrliaelgstsits
    lgfrdnwvfcggkspfeqhiknnketnkyegwpevvemegcipq
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >5lc3B (B:)
    mplllllpllwagalaelhhhhhhenlyfqsgrykcgiskacpekhfafkmasgaanvvg
    pkiclednvlmsgvknnvgrginialvngktgevidtkffdmwggdvapfieflktiqdg
    tvvlmatyddgatkltdearrliaelgstsitslgfrdnwvfcggkgiktkspfeqhikn
    nketnkyegwpevvemegcipqkqd
    

    Sequence, based on observed residues (ATOM records):
    >5lc3B (B:)
    ykcgiskacpekhfafkmasgaanvvgpkiclednvlmsgvknnvgrginialvngktge
    vidtkffdmwggdvapfieflktiqdgtvvlmatyddgatkltdearrliaelgstsits
    lgfrdnwvfcggkfeqhiknnketnkyegwpevvemegcipq