PDB entry 5lbz

View 5lbz on RCSB PDB site
Description: Structure of the human quinone reductase 2 (NQO2) in complex with pacritinib
Class: oxidoreductase
Keywords: quinone reductase 2, kinase inhibitor, pancritinib, Ribosyldihydronicotinamide dehydrogenase (NQO2), oxidoreductase
Deposited on 2016-06-17, released 2017-11-29
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-12-13, with a file datestamp of 2017-12-08.
Experiment type: XRAY
Resolution: 1.4 Å
R-factor: N/A
AEROSPACI score: 0.54 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ribosyldihydronicotinamide dehydrogenase [quinone]
    Species: Homo sapiens [TaxId:9606]
    Gene: NQO2, NMOR2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5lbza_
  • Chain 'B':
    Compound: Ribosyldihydronicotinamide dehydrogenase [quinone]
    Species: Homo sapiens [TaxId:9606]
    Gene: NQO2, NMOR2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5lbzb_
  • Heterogens: FAD, 6T3, SO4, ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5lbzA (A:)
    magkkvlivyahqepksfngslknvavdelsrqgctvtvsdlyamnlepratdkditgtl
    snpevfnygvetheaykqrslasditdeqkkvreadlvifqfplywfsvpailkgwmdrv
    lcqgfafdipgfydsgllqgklallsvttggtaemytktgvngdsryflwplqhgtlhfc
    gfkvlapqisfapeiaseeerkgmvaawsqrlqtiwkeepipctahwhfgqhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5lbzA (A:)
    kkvlivyahqepksfngslknvavdelsrqgctvtvsdlyamnlepratdkditgtlsnp
    evfnygvetheaykqrslasditdeqkkvreadlvifqfplywfsvpailkgwmdrvlcq
    gfafdipgfydsgllqgklallsvttggtaemytktgvngdsryflwplqhgtlhfcgfk
    vlapqisfapeiaseeerkgmvaawsqrlqtiwkeepipctahwhfg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5lbzB (B:)
    magkkvlivyahqepksfngslknvavdelsrqgctvtvsdlyamnlepratdkditgtl
    snpevfnygvetheaykqrslasditdeqkkvreadlvifqfplywfsvpailkgwmdrv
    lcqgfafdipgfydsgllqgklallsvttggtaemytktgvngdsryflwplqhgtlhfc
    gfkvlapqisfapeiaseeerkgmvaawsqrlqtiwkeepipctahwhfgqhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5lbzB (B:)
    kkvlivyahqepksfngslknvavdelsrqgctvtvsdlyamnlepratdkditgtlsnp
    evfnygvetheaykqrslasditdeqkkvreadlvifqfplywfsvpailkgwmdrvlcq
    gfafdipgfydsgllqgklallsvttggtaemytktgvngdsryflwplqhgtlhfcgfk
    vlapqisfapeiaseeerkgmvaawsqrlqtiwkeepipctahwhfg