PDB entry 5lbx

View 5lbx on RCSB PDB site
Description: structure of the t175v etr1p mutant in the trigonal form p312 in complex with nadp and crotonyl-coa
Deposited on 2016-06-17, released 2017-05-10
The last revision was dated 2017-06-28, with a file datestamp of 2017-06-23.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: N/A
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: enoyl-[acyl-carrier-protein] reductase [nadph, b-specific] 1, mitochondrial
    Species: Candida tropicalis [TaxId:5482]
    Gene: ETR1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8WZM3 (21-384)
      • expression tag (20)
      • engineered mutation (173)
  • Chain 'B':
    Compound: enoyl-[acyl-carrier-protein] reductase [nadph, b-specific] 1, mitochondrial
    Species: Candida tropicalis [TaxId:5482]
    Gene: ETR1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8WZM3 (21-384)
      • expression tag (20)
      • engineered mutation (173)
  • Heterogens: NAP, SO4, COO, CL, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >5lbxA (A:)
    mghhhhhhhhhhssghiegrhmitaqavlytqhgepkdvlftqsfeidddnlapnevivk
    tlgspvnpsdinqiqgvypskpakttgfgttepaapcgneglfevikvgsnvssleagdw
    vipshvnfgtwrthalgndddfiklpnpaqskangkpngltinqgatisvnplvaylmlt
    hyvkltpgkdwfiqnggtsavgkyasqigkllnfnsisvirdrpnldevvaslkelgatq
    vitedqnnsrefgptikewikqsggeaklalncvggksstgiarklnnnglmltyggmsf
    qpvtiptslyifknftsagfwvtellknnkelktstlnqiiawyeegkltdaksietlyd
    gtkplhelyqdgvanskdgkqlity
    

    Sequence, based on observed residues (ATOM records):
    >5lbxA (A:)
    hmitaqavlytqhgepkdvlftqsfeidddnlapnevivktlgspvnpsdinqiqgvyps
    kpakttgfgttepaapcgneglfevikvgsnvssleagdwvipshvnfgtwrthalgndd
    dfiklpnpaqskangkpngltinqgatisvnplvaylmlthyvkltpgkdwfiqnggtsa
    vgkyasqigkllnfnsisvirdrpnldevvaslkelgatqvitedqnnsrefgptikewi
    kqsggeaklalncvggksstgiarklnnnglmltyggmsfqpvtiptslyifknftsagf
    wvtellknnkelktstlnqiiawyeegkltdaksietlydgtkplhelyqdgvanskdgk
    qlity
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >5lbxB (B:)
    mghhhhhhhhhhssghiegrhmitaqavlytqhgepkdvlftqsfeidddnlapnevivk
    tlgspvnpsdinqiqgvypskpakttgfgttepaapcgneglfevikvgsnvssleagdw
    vipshvnfgtwrthalgndddfiklpnpaqskangkpngltinqgatisvnplvaylmlt
    hyvkltpgkdwfiqnggtsavgkyasqigkllnfnsisvirdrpnldevvaslkelgatq
    vitedqnnsrefgptikewikqsggeaklalncvggksstgiarklnnnglmltyggmsf
    qpvtiptslyifknftsagfwvtellknnkelktstlnqiiawyeegkltdaksietlyd
    gtkplhelyqdgvanskdgkqlity
    

    Sequence, based on observed residues (ATOM records):
    >5lbxB (B:)
    hmitaqavlytqhgepkdvlftqsfeidddnlapnevivktlgspvnpsdinqiqgvyps
    kpakttgfgttepaapcgneglfevikvgsnvssleagdwvipshvnfgtwrthalgndd
    dfiklpnpaqskangkpngltinqgatisvnplvaylmlthyvkltpgkdwfiqnggtsa
    vgkyasqigkllnfnsisvirdrpnldevvaslkelgatqvitedqnnsrefgptikewi
    kqsggeaklalncvggksstgiarklnnnglmltyggmsfqpvtiptslyifknftsagf
    wvtellknnkelktstlnqiiawyeegkltdaksietlydgtkplhelyqdgvanskdgk
    qlity