PDB entry 5lbt

View 5lbt on RCSB PDB site
Description: Structure of the human quinone reductase 2 (NQO2) in complex with imiquimod
Class: oxidoreductase
Keywords: quinone reductase 2 ribosyldihydronicotinamide dehydrogenase, OXIDOREDUCTASE
Deposited on 2016-06-17, released 2016-07-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-12-14, with a file datestamp of 2016-12-09.
Experiment type: XRAY
Resolution: 1.75 Å
R-factor: N/A
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ribosyldihydronicotinamide dehydrogenase [quinone]
    Species: Homo sapiens [TaxId:9606]
    Gene: NQO2, NMOR2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5lbta_
  • Chain 'B':
    Compound: Ribosyldihydronicotinamide dehydrogenase [quinone]
    Species: Homo sapiens [TaxId:9606]
    Gene: NQO2, NMOR2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5lbtb_
  • Heterogens: ZN, FAD, 6T0, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5lbtA (A:)
    magkkvlivyahqepksfngslknvavdelsrqgctvtvsdlyamnlepratdkditgtl
    snpevfnygvetheaykqrslasditdeqkkvreadlvifqfplywfsvpailkgwmdrv
    lcqgfafdipgfydsgllqgklallsvttggtaemytktgvngdsryflwplqhgtlhfc
    gfkvlapqisfapeiaseeerkgmvaawsqrlqtiwkeepipctahwhfgqhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5lbtA (A:)
    gkkvlivyahqepksfngslknvavdelsrqgctvtvsdlyamnlepratdkditgtlsn
    pevfnygvetheaykqrslasditdeqkkvreadlvifqfplywfsvpailkgwmdrvlc
    qgfafdipgfydsgllqgklallsvttggtaemytktgvngdsryflwplqhgtlhfcgf
    kvlapqisfapeiaseeerkgmvaawsqrlqtiwkeepipctahwhfg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5lbtB (B:)
    magkkvlivyahqepksfngslknvavdelsrqgctvtvsdlyamnlepratdkditgtl
    snpevfnygvetheaykqrslasditdeqkkvreadlvifqfplywfsvpailkgwmdrv
    lcqgfafdipgfydsgllqgklallsvttggtaemytktgvngdsryflwplqhgtlhfc
    gfkvlapqisfapeiaseeerkgmvaawsqrlqtiwkeepipctahwhfgqhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5lbtB (B:)
    gkkvlivyahqepksfngslknvavdelsrqgctvtvsdlyamnlepratdkditgtpev
    fnygvetheaykqrslasditdeqkkvreadlvifqfplywfsvpailkgwmdrvlcqgf
    afdipgfydsgllqgklallsvttggtaemytktgvngdsryflwplqhgtlhfcgfkvl
    apqisfapeiaseeerkgmvaawsqrlqtiwkeepipctahwhfgq