PDB entry 5lbj

View 5lbj on RCSB PDB site
Description: solution structure of the bacterial toxin ldrd in tetrafluorethanol
Deposited on 2016-06-16, released 2017-08-02
The last revision was dated 2019-05-08, with a file datestamp of 2019-05-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.06 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Small toxic polypeptide LdrD
    Species: Escherichia coli, synthetic [TaxId:562]
    Database cross-references and differences (RAF-indexed):

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >5lbjA (A:)
    mtfaelgmafwhdlaapviagilasmivnwlnkrk