PDB entry 5lbh

View 5lbh on RCSB PDB site
Description: Crystal structure of Helicobacter cinaedi CAIP
Class: transport protein
Keywords: dps-like protein Neutrophile activating protein mini-ferritin, TRANSPORT PROTEIN
Deposited on 2016-06-16, released 2017-04-26
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-04-26, with a file datestamp of 2017-04-21.
Experiment type: XRAY
Resolution: 2.55 Å
R-factor: N/A
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: caip
    Species: Helicobacter cinaedi [TaxId:213]
    Gene: HCN_0606
    Database cross-references and differences (RAF-indexed):
    • PDB 5LBH (Start-144)
    Domains in SCOPe 2.07: d5lbha_
  • Chain 'B':
    Compound: caip
    Species: Helicobacter cinaedi [TaxId:213]
    Gene: HCN_0606
    Database cross-references and differences (RAF-indexed):
    • PDB 5LBH (Start-144)
    Domains in SCOPe 2.07: d5lbhb_
  • Chain 'C':
    Compound: caip
    Species: Helicobacter cinaedi [TaxId:213]
    Gene: HCN_0606
    Database cross-references and differences (RAF-indexed):
    • PDB 5LBH (Start-144)
    Domains in SCOPe 2.07: d5lbhc_
  • Chain 'D':
    Compound: caip
    Species: Helicobacter cinaedi [TaxId:213]
    Gene: HCN_0606
    Database cross-references and differences (RAF-indexed):
    • PDB 5LBH (Start-144)
    Domains in SCOPe 2.07: d5lbhd_
  • Chain 'E':
    Compound: caip
    Species: Helicobacter cinaedi [TaxId:213]
    Gene: HCN_0606
    Database cross-references and differences (RAF-indexed):
    • PDB 5LBH (Start-144)
    Domains in SCOPe 2.07: d5lbhe_
  • Chain 'F':
    Compound: caip
    Species: Helicobacter cinaedi [TaxId:213]
    Gene: HCN_0606
    Database cross-references and differences (RAF-indexed):
    • PDB 5LBH (Start-144)
    Domains in SCOPe 2.07: d5lbhf_
  • Chain 'G':
    Compound: caip
    Species: Helicobacter cinaedi [TaxId:213]
    Gene: HCN_0606
    Database cross-references and differences (RAF-indexed):
    • PDB 5LBH (Start-144)
    Domains in SCOPe 2.07: d5lbhg_
  • Chain 'H':
    Compound: caip
    Species: Helicobacter cinaedi [TaxId:213]
    Gene: HCN_0606
    Database cross-references and differences (RAF-indexed):
    • PDB 5LBH (Start-144)
    Domains in SCOPe 2.07: d5lbhh_
  • Chain 'I':
    Compound: caip
    Species: Helicobacter cinaedi [TaxId:213]
    Gene: HCN_0606
    Database cross-references and differences (RAF-indexed):
    • PDB 5LBH (Start-144)
    Domains in SCOPe 2.07: d5lbhi_
  • Chain 'J':
    Compound: caip
    Species: Helicobacter cinaedi [TaxId:213]
    Gene: HCN_0606
    Database cross-references and differences (RAF-indexed):
    • PDB 5LBH (Start-144)
    Domains in SCOPe 2.07: d5lbhj_
  • Chain 'K':
    Compound: caip
    Species: Helicobacter cinaedi [TaxId:213]
    Gene: HCN_0606
    Database cross-references and differences (RAF-indexed):
    • PDB 5LBH (Start-144)
    Domains in SCOPe 2.07: d5lbhk_
  • Chain 'L':
    Compound: caip
    Species: Helicobacter cinaedi [TaxId:213]
    Gene: HCN_0606
    Database cross-references and differences (RAF-indexed):
    • PDB 5LBH (Start-144)
    Domains in SCOPe 2.07: d5lbhl_
  • Heterogens: FE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5lbhA (A:)
    mskvvellkqiqadasvfyvkvhnfhwnvkgmdfhpthkatqeiyeqfadvfddvaervl
    qlgempyvtladmlkaakikeesktsfcskeiaqavladyeyflklftelsaqadsqgdk
    vsaayaddkvgelqkaiwmlksqla
    

    Sequence, based on observed residues (ATOM records): (download)
    >5lbhA (A:)
    kvvellkqiqadasvfyvkvhnfhwnvkgmdfhpthkatqeiyeqfadvfddvaervlql
    gempyvtladmlkaakikeesktsfcskeiaqavladyeyflklftelsaqadsqgdkvs
    aayaddkvgelqkaiwmlksqla
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5lbhB (B:)
    mskvvellkqiqadasvfyvkvhnfhwnvkgmdfhpthkatqeiyeqfadvfddvaervl
    qlgempyvtladmlkaakikeesktsfcskeiaqavladyeyflklftelsaqadsqgdk
    vsaayaddkvgelqkaiwmlksqla
    

    Sequence, based on observed residues (ATOM records): (download)
    >5lbhB (B:)
    kvvellkqiqadasvfyvkvhnfhwnvkgmdfhpthkatqeiyeqfadvfddvaervlql
    gempyvtladmlkaakikeesktsfcskeiaqavladyeyflklftelsaqadsqgdkvs
    aayaddkvgelqkaiwmlksqla
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5lbhC (C:)
    mskvvellkqiqadasvfyvkvhnfhwnvkgmdfhpthkatqeiyeqfadvfddvaervl
    qlgempyvtladmlkaakikeesktsfcskeiaqavladyeyflklftelsaqadsqgdk
    vsaayaddkvgelqkaiwmlksqla
    

    Sequence, based on observed residues (ATOM records): (download)
    >5lbhC (C:)
    kvvellkqiqadasvfyvkvhnfhwnvkgmdfhpthkatqeiyeqfadvfddvaervlql
    gempyvtladmlkaakikeesktsfcskeiaqavladyeyflklftelsaqadsqgdkvs
    aayaddkvgelqkaiwmlksqla
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5lbhD (D:)
    mskvvellkqiqadasvfyvkvhnfhwnvkgmdfhpthkatqeiyeqfadvfddvaervl
    qlgempyvtladmlkaakikeesktsfcskeiaqavladyeyflklftelsaqadsqgdk
    vsaayaddkvgelqkaiwmlksqla
    

    Sequence, based on observed residues (ATOM records): (download)
    >5lbhD (D:)
    kvvellkqiqadasvfyvkvhnfhwnvkgmdfhpthkatqeiyeqfadvfddvaervlql
    gempyvtladmlkaakikeesktsfcskeiaqavladyeyflklftelsaqadsqgdkvs
    aayaddkvgelqkaiwmlksqla
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >5lbhE (E:)
    mskvvellkqiqadasvfyvkvhnfhwnvkgmdfhpthkatqeiyeqfadvfddvaervl
    qlgempyvtladmlkaakikeesktsfcskeiaqavladyeyflklftelsaqadsqgdk
    vsaayaddkvgelqkaiwmlksqla
    

    Sequence, based on observed residues (ATOM records): (download)
    >5lbhE (E:)
    kvvellkqiqadasvfyvkvhnfhwnvkgmdfhpthkatqeiyeqfadvfddvaervlql
    gempyvtladmlkaakikeesktsfcskeiaqavladyeyflklftelsaqadsqgdkvs
    aayaddkvgelqkaiwmlksqla
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >5lbhF (F:)
    mskvvellkqiqadasvfyvkvhnfhwnvkgmdfhpthkatqeiyeqfadvfddvaervl
    qlgempyvtladmlkaakikeesktsfcskeiaqavladyeyflklftelsaqadsqgdk
    vsaayaddkvgelqkaiwmlksqla
    

    Sequence, based on observed residues (ATOM records): (download)
    >5lbhF (F:)
    kvvellkqiqadasvfyvkvhnfhwnvkgmdfhpthkatqeiyeqfadvfddvaervlql
    gempyvtladmlkaakikeesktsfcskeiaqavladyeyflklftelsaqadsqgdkvs
    aayaddkvgelqkaiwmlksqla
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >5lbhG (G:)
    mskvvellkqiqadasvfyvkvhnfhwnvkgmdfhpthkatqeiyeqfadvfddvaervl
    qlgempyvtladmlkaakikeesktsfcskeiaqavladyeyflklftelsaqadsqgdk
    vsaayaddkvgelqkaiwmlksqla
    

    Sequence, based on observed residues (ATOM records): (download)
    >5lbhG (G:)
    kvvellkqiqadasvfyvkvhnfhwnvkgmdfhpthkatqeiyeqfadvfddvaervlql
    gempyvtladmlkaakikeesktsfcskeiaqavladyeyflklftelsaqadsqgdkvs
    aayaddkvgelqkaiwmlksqla
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >5lbhH (H:)
    mskvvellkqiqadasvfyvkvhnfhwnvkgmdfhpthkatqeiyeqfadvfddvaervl
    qlgempyvtladmlkaakikeesktsfcskeiaqavladyeyflklftelsaqadsqgdk
    vsaayaddkvgelqkaiwmlksqla
    

    Sequence, based on observed residues (ATOM records): (download)
    >5lbhH (H:)
    kvvellkqiqadasvfyvkvhnfhwnvkgmdfhpthkatqeiyeqfadvfddvaervlql
    gempyvtladmlkaakikeesktsfcskeiaqavladyeyflklftelsaqadsqgdkvs
    aayaddkvgelqkaiwmlksqla
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >5lbhI (I:)
    mskvvellkqiqadasvfyvkvhnfhwnvkgmdfhpthkatqeiyeqfadvfddvaervl
    qlgempyvtladmlkaakikeesktsfcskeiaqavladyeyflklftelsaqadsqgdk
    vsaayaddkvgelqkaiwmlksqla
    

    Sequence, based on observed residues (ATOM records): (download)
    >5lbhI (I:)
    kvvellkqiqadasvfyvkvhnfhwnvkgmdfhpthkatqeiyeqfadvfddvaervlql
    gempyvtladmlkaakikeesktsfcskeiaqavladyeyflklftelsaqadsqgdkvs
    aayaddkvgelqkaiwmlksqla
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >5lbhJ (J:)
    mskvvellkqiqadasvfyvkvhnfhwnvkgmdfhpthkatqeiyeqfadvfddvaervl
    qlgempyvtladmlkaakikeesktsfcskeiaqavladyeyflklftelsaqadsqgdk
    vsaayaddkvgelqkaiwmlksqla
    

    Sequence, based on observed residues (ATOM records): (download)
    >5lbhJ (J:)
    kvvellkqiqadasvfyvkvhnfhwnvkgmdfhpthkatqeiyeqfadvfddvaervlql
    gempyvtladmlkaakikeesktsfcskeiaqavladyeyflklftelsaqadsqgdkvs
    aayaddkvgelqkaiwmlksqla
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >5lbhK (K:)
    mskvvellkqiqadasvfyvkvhnfhwnvkgmdfhpthkatqeiyeqfadvfddvaervl
    qlgempyvtladmlkaakikeesktsfcskeiaqavladyeyflklftelsaqadsqgdk
    vsaayaddkvgelqkaiwmlksqla
    

    Sequence, based on observed residues (ATOM records): (download)
    >5lbhK (K:)
    kvvellkqiqadasvfyvkvhnfhwnvkgmdfhpthkatqeiyeqfadvfddvaervlql
    gempyvtladmlkaakikeesktsfcskeiaqavladyeyflklftelsaqadsqgdkvs
    aayaddkvgelqkaiwmlksqla
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >5lbhL (L:)
    mskvvellkqiqadasvfyvkvhnfhwnvkgmdfhpthkatqeiyeqfadvfddvaervl
    qlgempyvtladmlkaakikeesktsfcskeiaqavladyeyflklftelsaqadsqgdk
    vsaayaddkvgelqkaiwmlksqla
    

    Sequence, based on observed residues (ATOM records): (download)
    >5lbhL (L:)
    kvvellkqiqadasvfyvkvhnfhwnvkgmdfhpthkatqeiyeqfadvfddvaervlql
    gempyvtladmlkaakikeesktsfcskeiaqavladyeyflklftelsaqadsqgdkvs
    aayaddkvgelqkaiwmlksqla