PDB entry 5lbg

View 5lbg on RCSB PDB site
Description: crystal structure of the mycobacterium tuberculosis l,d- transpeptidase-2 (ldtmt2) bc-module with faropenem-derived adduct at the active site cysteine-354
Deposited on 2016-06-16, released 2017-01-18
The last revision was dated 2017-03-15, with a file datestamp of 2017-03-10.
Experiment type: XRAY
Resolution: 1.54 Å
R-factor: N/A
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: L,D-transpeptidase 2
    Species: Mycobacterium tuberculosis [TaxId:83331]
    Gene: ldtB, MT2594, V735_02606
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: L,D-transpeptidase 2
    Species: Mycobacterium tuberculosis [TaxId:83331]
    Gene: ldtB, MT2594, V735_02606
    Database cross-references and differences (RAF-indexed):
  • Heterogens: 3HL, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >5lbgA (A:)
    smahltmpyvmpgdgevvgvgepvairfdeniadrgaaekaikittnppvegafywlnnr
    evrwrpehfwkpgtavdvavntygvdlgegmfgednvqthftigdeviataddntkiltv
    rvngevvksmptsmgkdstptangiyivgsrykhiimdsstygvpvnspngyrtdvdwat
    qisysgvfvhsapwsvgaqghtntshgclnvspsnaqwfydhvkrgdivevvntvggtlp
    gidglgdwnipwdqwragnaka
    

    Sequence, based on observed residues (ATOM records):
    >5lbgA (A:)
    hltmpyvmpgdgevvgvgepvairfdeniadrgaaekaikittnppvegafywlnnrevr
    wrpehfwkpgtavdvavntygvdlgegmfgednvqthftigdeviataddntkiltvrvn
    gevvksmptsmgkdstptangiyivgsrykhiimdsstygvpvnspngyrtdvdwatqis
    ysgvfvhsapwsvgaqghtntshgclnvspsnaqwfydhvkrgdivevvntvggtlpgid
    glgdwnipwdqwragnaka
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >5lbgB (B:)
    smahltmpyvmpgdgevvgvgepvairfdeniadrgaaekaikittnppvegafywlnnr
    evrwrpehfwkpgtavdvavntygvdlgegmfgednvqthftigdeviataddntkiltv
    rvngevvksmptsmgkdstptangiyivgsrykhiimdsstygvpvnspngyrtdvdwat
    qisysgvfvhsapwsvgaqghtntshgclnvspsnaqwfydhvkrgdivevvntvggtlp
    gidglgdwnipwdqwragnaka
    

    Sequence, based on observed residues (ATOM records):
    >5lbgB (B:)
    hltmpyvmpgdgevvgvgepvairfdeniadrgaaekaikittnppvegafywlnnrevr
    wrpehfwkpgtavdvavntygvdlgegmfgednvqthftigdeviataddntkiltvrvn
    gevvksmptsmgkdstptangiyivgsrykhiimdsstygvpvnspngyrtdvdwatqis
    ysgvfvhsapwsvgaqghtntshgclnvspsnaqwfydhvkrgdivevvntvggtlpgid
    glgdwnipwdqwragnaka