PDB entry 5lbe

View 5lbe on RCSB PDB site
Description: HIF prolyl hydroxylase 2 (PHD2/EGLN1) G294E variant in complex with Mn(II) and N-[(1-chloro-4-hydroxyisoquinolin-3-yl)carbonyl]glycine (IOX3/FG2216)
Class: oxidoreductase
Keywords: oxidoreductase, non-heme dioxygenase, iron, 2-oxoglutarate, hypoxia-inducible factor, hif, hif prolyl hydroxylase domain 2, phd2, egln1, oxygenase, hypoxia, DNA-binding, metal-binding, transcription, helix-loop-helix-beta, dsbh, facial triad, cytoplasm, transcription/epigenetic regulation, signaling, development, cell structure, beta-hydroxylation, transcription activator/inhibitor, ubl conjugation, polymorphism, vitamin c, zinc-finger, familial erythrocytosis, breast cancer, transcription complex
Deposited on 2016-06-15, released 2016-08-31
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-29, with a file datestamp of 2017-11-24.
Experiment type: XRAY
Resolution: 1.75 Å
R-factor: N/A
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Egl nine homolog 1
    Species: Homo sapiens [TaxId:9606]
    Gene: EGLN1, C1orf12, PNAS-118, PNAS-137
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9GZT9
      • engineered mutation (119)
    Domains in SCOPe 2.07: d5lbea_
  • Heterogens: MN, UN9, BCT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5lbeA (A:)
    gshmaspngqtkplpalklaleyivpcmnkhgicvvddflgketgqqigdevralhdtgk
    ftdgqlvsqksdsskdirgdkitwiegkepgcetigllmssmddlirhcngklgsykine
    rtkamvacypgngtgyvrhvdnpngdgrcvtciyylnkdwdakvsggilrifpegkaqfa
    diepkfdrllffwsdrrnphevqpayatryaitvwyfdaderarakvkyltgekgvrvel
    nkpsdsvgkdvf
    

    Sequence, based on observed residues (ATOM records): (download)
    >5lbeA (A:)
    lpalklaleyivpcmnkhgicvvddflgketgqqigdevralhdtgkftdgqlvsqdssk
    dirgdkitwiegkepgcetigllmssmddlirhcngklgsykinertkamvacypgngtg
    yvrhvdnpngdgrcvtciyylnkdwdakvsggilrifpegkaqfadiepkfdrllffwsd
    rrnphevqpayatryaitvwyfdaderarakvkylgvrve