PDB entry 5lb3

View 5lb3 on RCSB PDB site
Description: crystal structure of human recql5 helicase in complex with adp/mg.
Deposited on 2016-06-15, released 2016-07-06
The last revision was dated 2018-01-24, with a file datestamp of 2018-01-19.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: N/A
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'B':
    Compound: ATP-dependent DNA helicase q5
    Species: Homo sapiens [TaxId:9606]
    Gene: RECQL5, RECQ5
    Database cross-references and differences (RAF-indexed):
    • Uniprot O94762 (2-444)
      • expression tag (1)
  • Chain 'E':
    Compound: ATP-dependent DNA helicase q5
    Species: Homo sapiens [TaxId:9606]
    Gene: RECQL5, RECQ5
    Database cross-references and differences (RAF-indexed):
    • Uniprot O94762 (2-444)
      • expression tag (1)
  • Heterogens: ZN, ADP, MG, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'B':
    Sequence, based on SEQRES records:
    >5lb3B (B:)
    msdperrvrstlkkvfgfdsfktplqesatmavvkgnkdvfvcmptgagkslcyqlpall
    akgitivvsplialiqdqvdhlltlkvrvsslnsklsaqerkelladlerekpqtkilyi
    tpemaasssfqptlnslvsrhllsylvvdeahcvsqwghdfrpdylrlgalrsrlghapc
    valtatatpqvqedvfaalhlkkpvaifktpcfranlfydvqfkelisdpygnlkdfclk
    algqeadkglsgcgivycrtreaceqlaielscrgvnakayhaglkasertlvqndwmee
    kvpvivatisfgmgvdkanvrfvahwniaksmagyyqesgragrdgkpswcrlyysrndr
    dqvsflirkevaklqekrgnkasdkatimafdalvtfceelgcrhaaiakyfgdalpaca
    kgcdhcqnptavrrrlealersssw
    

    Sequence, based on observed residues (ATOM records):
    >5lb3B (B:)
    sdperrvrstlkkvfgfdsfktplqesatmavvkgnkdvfvcmptgagkslcyqlpalla
    kgitivvsplialiqdqvdhlltlkvrvsslnsklsaqerkelladlerekpqtkilyit
    pemaasssfqptlnslvsrhllsylvvdeahcvsqwghdfrpdylrlgalrsrlghapcv
    altatatpqvqedvfaalhlkkpvaifktpcfranlfydvqfkelisdpygnlkdfclka
    lgqeadkglsgcgivycrtreaceqlaielscrgvnakayhaglkasertlvqndwmeek
    vpvivatisdkanvrfvahwniaksmagyyqesgragrdgkpswcrlyysrndrdqvsfl
    irkevaklqekrgnkasdkatimafdalvtfceelgcrhaaiakyfgdalpacakgcdhc
    qnptavrrrlealersssw
    

  • Chain 'E':
    Sequence, based on SEQRES records:
    >5lb3E (E:)
    msdperrvrstlkkvfgfdsfktplqesatmavvkgnkdvfvcmptgagkslcyqlpall
    akgitivvsplialiqdqvdhlltlkvrvsslnsklsaqerkelladlerekpqtkilyi
    tpemaasssfqptlnslvsrhllsylvvdeahcvsqwghdfrpdylrlgalrsrlghapc
    valtatatpqvqedvfaalhlkkpvaifktpcfranlfydvqfkelisdpygnlkdfclk
    algqeadkglsgcgivycrtreaceqlaielscrgvnakayhaglkasertlvqndwmee
    kvpvivatisfgmgvdkanvrfvahwniaksmagyyqesgragrdgkpswcrlyysrndr
    dqvsflirkevaklqekrgnkasdkatimafdalvtfceelgcrhaaiakyfgdalpaca
    kgcdhcqnptavrrrlealersssw
    

    Sequence, based on observed residues (ATOM records):
    >5lb3E (E:)
    sdperrvrstlkkvfgfdsfktplqesatmavvkgnkdvfvcmptgagkslcyqlpalla
    kgitivvsplialiqdqvdhlltlkvrvsslnsklsaqerkelladlerekpqtkilyit
    pemaasssfqptlnslvsrhllsylvvdeahcvsqwghdfrpdylrlgalrsrlghapcv
    altatatpqvqedvfaalhlkkpvaifktpcfranlfydvqfkelisdpygnlkdfclka
    lgqeaglsgcgivycrtreaceqlaielscrgvnakayhaglkasertlvqndwmeekvp
    vivatisfvdkanvrfvahwniaksmagyyqesgragrdgkpswcrlyysrndrdqvsfl
    irkevaklqekrgnkasdkatimafdalvtfceelgcrhaaiakyfgdalpacakgcdhc
    qnptavrrrlealersssw