PDB entry 5law

View 5law on RCSB PDB site
Description: Novel Spiro[3H-indole-3,2 -pyrrolidin]-2(1H)-one Inhibitors of the MDM2-p53 Interaction: HDM2 (MDM2) IN COMPLEX WITH COMPOUND 14
Class: ligase
Keywords: VIENNA, PPI, MDM2, HDM2, BI, ligase
Deposited on 2016-06-15, released 2016-11-02
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-09-25, with a file datestamp of 2019-09-20.
Experiment type: XRAY
Resolution: 1.64 Å
R-factor: N/A
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: E3 ubiquitin-protein ligase Mdm2
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q00987 (0-93)
  Domains in SCOPe 2.08: d5lawa_
• Heterogens: 6SJ, SO4, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >5lawA (A:)
  qipaseqetlvrpkplllkllksvgaqkdtytmkevlfylgqyimtkrlydekqqhivyc
  sndllgdlfgvpsfsvkehrkiytmiyrnlvvvn