PDB entry 5laq

View 5laq on RCSB PDB site
Description: Crystal structure of human phosphodiesterase 4B catalytic domain with inhibitor NPD-001
Class: hydrolase
Keywords: Phosphodiesterase, hydrolase, cAMP, alternative splicing
Deposited on 2016-06-14, released 2018-03-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-03-14, with a file datestamp of 2018-03-09.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: N/A
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cAMP-specific 3',5'-cyclic phosphodiesterase 4B,cAMP-specific 3',5'-cyclic phosphodiesterase 4B
    Species: Homo sapiens [TaxId:9606]
    Gene: PDE4B, DPDE4
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5laqa_
  • Heterogens: ZN, MG, ACT, 6M5, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5laqA (A:)
    msvsemasnkfkrmlnrelthlsemsrsgnqvseyisntfldkqndveipkvtaeeapqp
    mtqisgvkklmhssslnntsisrfgvntenedhlakeledlnkwglnifnvagyshnrpl
    tcimyaifqerdllktfrissdtfitymmtledhyhsdvayhnslhaadvaqsthvllst
    paldavftdleilaaifaaaihdvdhpgvsnqflintnselalmyndesvlenhhlavgf
    kllqeehcdifmnltkkqrqtlrkmvidmvlatdmskhmslladlktmvetkkvtssgvl
    lldnytdriqvlrnmvhcadlsnptkslelyrqwtdrimeeffqqgdkerergmeispmc
    dkhtasveksqvgfidyivhplwetwadlvqpdaqdildtlednrnwyqsmipqshhhhh
    h
    

    Sequence, based on observed residues (ATOM records): (download)
    >5laqA (A:)
    tsisrfgvntenedhlakeledlnkwglnifnvagyshnrpltcimyaifqerdllktfr
    issdtfitymmtledhyhsdvayhnslhaadvaqsthvllstpaldavftdleilaaifa
    aaihdvdhpgvsnqflintnselalmyndesvlenhhlavgfkllqeehcdifmnltkkq
    rqtlrkmvidmvlatdmskhmslladlktmvetkkvtssgvllldnytdriqvlrnmvhc
    adlsnptkslelyrqwtdrimeeffqqgdkerergmeispmcdkhtasveksqvgfidyi
    vhplwetwadlvqpdaqdildtlednrnwyqsmipqs