PDB entry 5lam

View 5lam on RCSB PDB site
Description: refined 3d nmr structure of the cytoplasmic rhodanese domain of the inner membrane protein ygap from escherichia coli
Deposited on 2016-06-14, released 2016-08-17
The last revision was dated 2019-10-23, with a file datestamp of 2019-10-18.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Inner membrane protein YgaP
    Species: Escherichia coli (strain K12) [TaxId:83333]
    Gene: ygaP, b2668, JW2643
    Database cross-references and differences (RAF-indexed):

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >5lamA (A:)
    alttisphdaqeliargaklidirdadeylrehipeadlaplsvleqsglpaklrheqii
    fhcqagkrtsnnadklaaiaapaeiflledgidgwkkaglpvavnksq