PDB entry 5lak

View 5lak on RCSB PDB site
Description: ligand-bound structure of cavally virus 3cl protease
Deposited on 2016-06-14, released 2017-07-12
The last revision was dated 2019-12-25, with a file datestamp of 2019-12-20.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: N/A
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 3Cl Protease
    Species: Cavally virus [TaxId:1041929]
    Gene: pp1ab, CAVV_gp1
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: 3Cl Protease
    Species: Cavally virus [TaxId:1041929]
    Gene: pp1ab, CAVV_gp1
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: 3Cl Protease
    Species: Cavally virus [TaxId:1041929]
    Gene: pp1ab, CAVV_gp1
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: 3Cl Protease
    Species: Cavally virus [TaxId:1041929]
    Gene: pp1ab, CAVV_gp1
    Database cross-references and differences (RAF-indexed):
  • Chain 'I':
    Compound: BEZ-TYR-TYR-ASN-ECC Peptide inhibitor
    Species: synthetic construct, synthetic [TaxId:32630]
    Database cross-references and differences (RAF-indexed):
    • PDB 5LAK (0-4)
  • Chain 'J':
    Compound: BEZ-TYR-TYR-ASN-ECC Peptide inhibitor
    Species: synthetic construct, synthetic [TaxId:32630]
    Database cross-references and differences (RAF-indexed):
    • PDB 5LAK (0-4)
  • Chain 'K':
    Compound: BEZ-TYR-TYR-ASN-ECC Peptide inhibitor
    Species: synthetic construct, synthetic [TaxId:32630]
    Database cross-references and differences (RAF-indexed):
    • PDB 5LAK (0-4)
  • Heterogens: 1PE, PGE, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >5lakA (A:)
    saasnpsishivlempvainplikyttrtsvsslrgavvngyiyiqrhlfgskkqefeac
    ynngkgllncknlerskydidsaeligtliriplhdkhsiphisihpdplsyngpvtlyl
    srydtelnkdvlcvhtgfmseghhdiktvfgdcggmlfdpkgrllglhcagsddvvfmdt
    ttgksniwtsyklqhpseimitlnneinlpnpanydfettkvvyqhplrnvcatletlqh
    ltnktnaklpydsrllsdfnitaeqynqygyyidynnfvnnfnryttttigtksfetcik
    yglmdnkkpdyynq
    

    Sequence, based on observed residues (ATOM records):
    >5lakA (A:)
    saasnpsishivlempvainplikyttrtsvsslrgavvngyiyiqrhlfgskkqefeac
    ynngkgllncknlerskydidsaeligtliriplhdkhsiphisihpdplsyngpvtlyl
    srydtnkdvlcvhtgfmseghhdiktvfgdcggmlfdpkgrllglhcagsddvvfmdttt
    gksniwtsyklqhpseimitlnneinlpnpanydfettkvvyqhplrnvcatletlqhlt
    nktnaklpydsrllsdfnitaeqynqygyyidynnfvnnfnryttttigtksfetcikyg
    lmd
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >5lakB (B:)
    saasnpsishivlempvainplikyttrtsvsslrgavvngyiyiqrhlfgskkqefeac
    ynngkgllncknlerskydidsaeligtliriplhdkhsiphisihpdplsyngpvtlyl
    srydtelnkdvlcvhtgfmseghhdiktvfgdcggmlfdpkgrllglhcagsddvvfmdt
    ttgksniwtsyklqhpseimitlnneinlpnpanydfettkvvyqhplrnvcatletlqh
    ltnktnaklpydsrllsdfnitaeqynqygyyidynnfvnnfnryttttigtksfetcik
    yglmdnkkpdyynq
    

    Sequence, based on observed residues (ATOM records):
    >5lakB (B:)
    saasnpsishivlempvainplikytsslrgavvngyiyiqrhlfgskkqefeacynngk
    gllncknlerskydidsaeligtliriplhdkhsiphisihpdplsyngpvtlylsrydt
    elnkdvlcvhtgfmseghhdiktvfgdcggmlfdpkgrllglhcagsddvvfmdsniwts
    ykqhpseimitlnneinlpnpanydfettkvvyqhplrnvcatletlqhltnktnaklpy
    dsrllsdfnitaeqynqygyyidynnfvnnfnryttttigtksfetcikyglmd
    

  • Chain 'C':
    Sequence, based on SEQRES records:
    >5lakC (C:)
    saasnpsishivlempvainplikyttrtsvsslrgavvngyiyiqrhlfgskkqefeac
    ynngkgllncknlerskydidsaeligtliriplhdkhsiphisihpdplsyngpvtlyl
    srydtelnkdvlcvhtgfmseghhdiktvfgdcggmlfdpkgrllglhcagsddvvfmdt
    ttgksniwtsyklqhpseimitlnneinlpnpanydfettkvvyqhplrnvcatletlqh
    ltnktnaklpydsrllsdfnitaeqynqygyyidynnfvnnfnryttttigtksfetcik
    yglmdnkkpdyynq
    

    Sequence, based on observed residues (ATOM records):
    >5lakC (C:)
    saasnpsishivlempvainplikyttrtsvsslrgavvngyiyiqrhlfgskkqefeac
    ynngkgllncknlerskydidsaeligtliriplhdkhsiphisihpdplsyngpvtlyl
    srydtnkdvlcvhtgfmseghhdiktvfgdcggmlfdpkgrllglhcagsddvvfmdttt
    gksniwtsyklqhpseimitlnneinlpnpanydfettkvvyqhplrnvcatletlqhlt
    nktnaklpydsrllsdfnitaeqynqygyyidynnfvnnfnryttttigtksfetcikyg
    lmd
    

  • Chain 'D':
    Sequence, based on SEQRES records:
    >5lakD (D:)
    saasnpsishivlempvainplikyttrtsvsslrgavvngyiyiqrhlfgskkqefeac
    ynngkgllncknlerskydidsaeligtliriplhdkhsiphisihpdplsyngpvtlyl
    srydtelnkdvlcvhtgfmseghhdiktvfgdcggmlfdpkgrllglhcagsddvvfmdt
    ttgksniwtsyklqhpseimitlnneinlpnpanydfettkvvyqhplrnvcatletlqh
    ltnktnaklpydsrllsdfnitaeqynqygyyidynnfvnnfnryttttigtksfetcik
    yglmdnkkpdyynq
    

    Sequence, based on observed residues (ATOM records):
    >5lakD (D:)
    saasnpsishivlempvainplikyttvsslrgavvngyiyiqrhlfgskefeacynckn
    lerskydidsaeligtliriplhdkhsiphisihpdplsyngpvtlylsrydtedvlcvh
    tgfmseghhdiktvfgdcggmlfdpkgrllglhcagsddvvfmdtttgksniwtsyklqh
    pseimitlnneinlpnpanydkvvyqhplrnvcatletlqhltnktnaklpydsrllsdf
    nitaeqynqygyyidynnfvnnfnryttttigtksfetcikyglmd
    

  • Chain 'I':
    Sequence; same for both SEQRES and ATOM records:
    >5lakI (I:)
    xyynx
    

  • Chain 'J':
    Sequence; same for both SEQRES and ATOM records:
    >5lakJ (J:)
    xyynx
    

  • Chain 'K':
    Sequence; same for both SEQRES and ATOM records:
    >5lakK (K:)
    xyynx