PDB entry 5lae

View 5lae on RCSB PDB site
Description: crystal structure of murine n1-acetylpolyamine oxidase
Deposited on 2016-06-14, released 2017-03-15
The last revision was dated 2017-03-15, with a file datestamp of 2017-03-10.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: N/A
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Peroxisomal N(1)-acetyl-spermine/spermidine oxidase,Peroxisomal N(1)-acetyl-spermine/spermidine oxidase
    Species: Mus musculus [TaxId:10090]
    Gene: Paox, Pao
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8C0L6 (Start-448)
      • linker (449)
    • Uniprot Q8C0L6 (450-End)
  • Heterogens: FAD, GOL, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >5laeA (A:)
    ggpgprvlvvgsgiaglgaaqklcshraaphlrvleatasaggrirsercfggvvelgah
    wihgpsqdnpvfqlaaefgllgekelseenqlvdtgghvalpsmiwsssgtsvslelmte
    marlfygliertreflnesetpmasvgeflkkeisqqvaswteddedtrkrklailntff
    nieccvsgthsmdlvalapfgeytvlpgldcilaggyqgltdrilaslpkdtvafdkpvk
    tihwngsfqeaafpgetfpvlvecedgarlpahhvivtvplgflkehqdtffepplpakk
    aeaikklgfgtnnkiflefeepfwepdcqfiqvvwedtsplqdtalslqdtwfkkligfl
    vqpsfesshvlcgfiaglesefmetlsdeevllsltqvlrrvtgnpqlpaaksvrrsqwh
    sapytrgsysyvavgstgddldlmaqplpglqvlfageathrtfystthgallsgwread
    rlvslwdsqveqsrprl
    

    Sequence, based on observed residues (ATOM records):
    >5laeA (A:)
    gprvlvvgsgiaglgaaqklcshraaphlrvleatasaggrirsercfggvvelgahwih
    gpsqdnpvfqlaaefgllgekelspsmiwsssgtsvslelmtemarlfygliertreasv
    geflkkeisqqvedtrkrklailntffnieccvsgthsmdlvalapfgeytvlpgldcil
    aggyqgltdrilaslpkdtvafdkpvktihwngsfqeaafpgetfpvlvecedgarlpah
    hvivtvplgflkehqdtffepplpakkaeaikklgfgtnnkiflefeepfwepdcqfiqv
    vwedtsplqdtalslqdtwfkkligflvqpshvlcgfiaglesefmetlsdeevllsltq
    vlrrvtgnpqlpaaksvrrsqwhsapytrgsysyvavgstgddldlmaqplpglqvlfag
    eathrtfystthgallsgwreadrlvslwdsqveq