PDB entry 5la4

View 5la4 on RCSB PDB site
Description: crystal structure of apo human proheparanase
Deposited on 2016-06-13, released 2017-05-31
The last revision was dated 2020-07-29, with a file datestamp of 2020-06-29.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: N/A
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Heparanase
    Species: Homo sapiens [TaxId:9606]
    Gene: HPSE, HEP, HPA, HPA1, HPR1, HPSE1, HSE1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9Y251 (1-508)
      • variant (272)
  • Heterogens: NAG, EDO, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >5la4A (A:)
    gqdvvdldfftqeplhlvspsflsvtidanlatdprflillgspklrtlarglspaylrf
    ggtktdflifdpkkestfeersywqsqvnqdickygsippdveeklrlewpyqeqlllre
    hyqkkfknstysrssvdvlytfancsgldlifglnallrtadlqwnssnaqllldycssk
    gyniswelgnepnsflkkadifingsqlgedfiqlhkllrkstfknaklygpdvgqprrk
    takmlksflkaggevidsvtwhhyylngrtatredflnpdvldifissvqkvfqvvestr
    pgkkvwlgetssaygggapllsdtfaagfmwldklglsarmgievvmrqvffgagnyhlv
    denfdplpdywlsllfkklvgtkvlmasvqgskrrklrvylhctntdnprykegdltlya
    inlhnvtkylrlpypfsnkqvdkyllrplgphgllsksvqlngltlkmvddqtlpplmek
    plrpgsslglpafsysffvirnakvaaci
    

    Sequence, based on observed residues (ATOM records):
    >5la4A (A:)
    qdvvdldfftqeplhlvspsflsvtidanlatdprflillgspklrtlarglspaylrfg
    gtktdflifdpkkestfeersywqsqvnqdickygsippdveeklrlewpyqeqlllreh
    yqkkfknstysrssvdvlytfancsgldlifglnallrtadlqwnssnaqllldycsskg
    yniswelgnepnsflkkadifingsqlgedfiqlhkllrkstfknaklygpdvgqprrkt
    akmlksflkaggevidsvtwhhyylngrtatredflnpdvldifissvqkvfqvvestrp
    gkkvwlgetssaygggapllsdtfaagfmwldklglsarmgievvmrqvffgagnyhlvd
    enfdplpdywlsllfkklvgtkvlmasvqgskrrklrvylhctntdnprykegdltlyai
    nlhnvtkylrlpypfsnkqvdkyllrplgphgllsksvqlngltlkmvddqtlpplmekp
    lrpgsslglpafsysffvirnakvaaci