PDB entry 5la1

View 5la1 on RCSB PDB site
Description: the mechanism by which arabinoxylanases can recognise highly decorated xylans
Deposited on 2016-06-13, released 2016-08-31
The last revision was dated 2020-07-29, with a file datestamp of 2020-06-29.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: N/A
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: carbohydrate binding family 6
    Species: Ruminiclostridium thermocellum JW20 [TaxId:492476]
    Gene: Cther_1146
    Database cross-references and differences (RAF-indexed):
  • Heterogens: XYP, CA, 144, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >5la1A (A:)
    masspqrgrprlnaarttfvgdngqplrgpytstewtaaapydqiarvkelgfnavhlya
    ecfdprypapgskapgyavneidkivertrelglylvitignganngnhnaqwardfwkf
    yapryakethvlyeihnepvawgppyssstanppgavdmeidvyriirtyapetpvllfs
    yavfggkggaaealkdirafnkavfgnenavwtneavafhgyagwqettiaveellkagy
    pcfmteyaggawgsgmggldveltyelerlgvswltfqyipptgvsddvtkpeyfsalve
    nsglswtpdygnwpaargvygngglaretatwinnfltgttrieaedfdwggngvsyydt
    dsvnvggqyrpdegvdiektsdtgggynvgwisegewleytirvrnpgyynlslrvagis
    gsrvqvsfgnqdktgvwelpatggfqtwttatrqvflgaglqklrinalsggfnlnwiel
    spilehhhhhh
    

    Sequence, based on observed residues (ATOM records):
    >5la1A (A:)
    asspqrgrprlnaarttfvgdngqplrgpytstewtaaapydqiarvkelgfnavhlyae
    cfdprypapgskapgyavneidkivertrelglylvitignganngnhnaqwardfwkfy
    apryakethvlyeihnepvawgppyssstanppgavdmeidvyriirtyapetpvllfsy
    avfggkggaaealkdirafnkavfgnenavwtneavafhgyagwqettiaveellkagyp
    cfmteyaggldveltyelerlgvswltfqyipptgvsddvtkpeyfsalvensglswtpd
    ygnwpaargvygngglaretatwinnfltgttrieaedfdwggngvsyydtdsvnvggqy
    rpdegvdiektsdtgggynvgwisegewleytirvrnpgyynlslrvagisgsrvqvsfg
    nqdktgvwelpatggfqtwttatrqvflgaglqklrinalsggfnlnwielspi