PDB entry 5l9z

View 5l9z on RCSB PDB site
Description: crystal structure of human heparanase nucleophile mutant (e343q), in complex with unreacted glucuronic acid configured aziridine probe jjb355
Deposited on 2016-06-13, released 2017-05-31
The last revision was dated 2020-07-29, with a file datestamp of 2020-06-29.
Experiment type: XRAY
Resolution: 1.57 Å
R-factor: N/A
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Heparanase
    Species: Homo sapiens [TaxId:9606]
    Gene: HPSE, HEP, HPA, HPA1, HPR1, HPSE1, HSE1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9Y251 (Start-388)
      • variant (152)
      • engineered mutation (188)
  • Chain 'B':
    Compound: Heparanase
    Species: Homo sapiens [TaxId:9606]
    Gene: HPSE, HEP, HPA, HPA1, HPR1, HPSE1, HSE1
    Database cross-references and differences (RAF-indexed):
  • Heterogens: NAG, EDO, CL, GUX, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >5l9zA (A:)
    dpgkkfknstysrssvdvlytfancsgldlifglnallrtadlqwnssnaqllldycssk
    gyniswelgnepnsflkkadifingsqlgedfiqlhkllrkstfknaklygpdvgqprrk
    takmlksflkaggevidsvtwhhyylngrtatredflnpdvldifissvqkvfqvvestr
    pgkkvwlgqtssaygggapllsdtfaagfmwldklglsarmgievvmrqvffgagnyhlv
    denfdplpdywlsllfkklvgtkvlmasvqgskrrklrvylhctntdnprykegdltlya
    inlhnvtkylrlpypfsnkqvdkyllrplgphgllsksvqlngltlkmvddqtlpplmek
    plrpgsslglpafsysffvirnakvaaci
    

    Sequence, based on observed residues (ATOM records):
    >5l9zA (A:)
    kfknstysrssvdvlytfancsgldlifglnallrtadlqwnssnaqllldycsskgyni
    swelgnepnsflkkadifingsqlgedfiqlhkllrkstfknaklygpdvgqprrktakm
    lksflkaggevidsvtwhhyylngrtatredflnpdvldifissvqkvfqvvestrpgkk
    vwlgqtssaygggapllsdtfaagfmwldklglsarmgievvmrqvffgagnyhlvdenf
    dplpdywlsllfkklvgtkvlmasvqgskrrklrvylhctntdnprykegdltlyainlh
    nvtkylrlpypfsnkqvdkyllrplgphgllsksvqlngltlkmvddqtlpplmekplrp
    gsslglpafsysffvirnakvaaci
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >5l9zB (B:)
    dpgqdvvdldfftqeplhlvspsflsvtidanlatdprflillgspklrtlarglspayl
    rfggtktdflifdpkke
    

    Sequence, based on observed residues (ATOM records):
    >5l9zB (B:)
    qdvvdldfftqeplhlvspsflsvtidanlatdprflillgspklrtlarglspaylrfg
    gtktdflifdpkke