PDB entry 5l9v

View 5l9v on RCSB PDB site
Description: hif prolyl hydroxylase 2 (phd2-r281c/p317c) cross-linked to hif-1alpha nodd-l397c/d412c and n-oxalylglycine (nog) (complex-1)
Deposited on 2016-06-11, released 2016-08-31
The last revision was dated 2017-11-29, with a file datestamp of 2017-11-24.
Experiment type: XRAY
Resolution: 1.83 Å
R-factor: N/A
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Egl nine homolog 1
    Species: Homo sapiens [TaxId:9606]
    Gene: EGLN1, C1orf12, PNAS-118, PNAS-137
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9GZT9
      • engineered mutation (26)
      • engineered mutation (106)
      • engineered mutation (142)
      • engineered mutation (223)
  • Chain 'B':
    Compound: Egl nine homolog 1
    Species: Homo sapiens [TaxId:9606]
    Gene: EGLN1, C1orf12, PNAS-118, PNAS-137
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9GZT9
      • engineered mutation (26)
      • engineered mutation (106)
      • engineered mutation (142)
      • engineered mutation (223)
  • Chain 'C':
    Compound: hypoxia-inducible factor 1-alpha
    Species: HOMO SAPIENS, synthetic [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q16665 (0-18)
      • engineered mutation (2)
      • engineered mutation (17)
  • Chain 'D':
    Compound: hypoxia-inducible factor 1-alpha
    Species: HOMO SAPIENS, synthetic [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q16665 (0-18)
      • engineered mutation (2)
      • engineered mutation (17)
  • Heterogens: MN, OGA, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >5l9vA (A:)
    gshmaspngqtkplpalklaleyivpamnkhgicvvddflgketgqqigdevralhdtgk
    ftdgqlvsqksdsskdirgdkitwiegkepgcetigllmssmddlichcngklgsyking
    rtkamvacypgngtgyvrhvdncngdgrcvtciyylnkdwdakvsggilrifpegkaqfa
    diepkfdrllffwsdrrnphevqpayatryaitvwyfdaderaaakvkyltgekgvrvel
    nkpsdsvgkdvf
    

    Sequence, based on observed residues (ATOM records):
    >5l9vA (A:)
    palklaleyivpamnkhgicvvddflgketgqqigdevralhdtgkftdgqlvsqksdss
    kdirgdkitwiegkepgcetigllmssmddlichcngklgsykingrtkamvacypgngt
    gyvrhvdncngdgrcvtciyylnkdwdakvsggilrifpegkaqfadiepkfdrllffws
    drrnphevqpayatryaitvwyfdaderaaakvky
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >5l9vB (B:)
    gshmaspngqtkplpalklaleyivpamnkhgicvvddflgketgqqigdevralhdtgk
    ftdgqlvsqksdsskdirgdkitwiegkepgcetigllmssmddlichcngklgsyking
    rtkamvacypgngtgyvrhvdncngdgrcvtciyylnkdwdakvsggilrifpegkaqfa
    diepkfdrllffwsdrrnphevqpayatryaitvwyfdaderaaakvkyltgekgvrvel
    nkpsdsvgkdvf
    

    Sequence, based on observed residues (ATOM records):
    >5l9vB (B:)
    palklaleyivpamnkhgicvvddflgketgqqigdevralhdtgkftdgqlvsqksdss
    kdirgdkitwiegkepgcetigllmssmddlichcngklgsykingrtkamvacypgngt
    gyvrhvdncngdgrcvtciyylnkdwdakvsggilrifpegkaqfadiepkfdrllffws
    drrnphevqpayatryaitvwyfdaderaaakvky
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records:
    >5l9vC (C:)
    dactllapaagdtiislcf
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records:
    >5l9vD (D:)
    dactllapaagdtiislcf