PDB entry 5l9t

View 5l9t on RCSB PDB site
Description: model of human anaphase-promoting complex/cyclosome (apc/c-cdh1) with e2 ube2s poised for polyubiquitination where ube2s, apc2, and apc11 are modeled into low resolution density
Deposited on 2016-06-11, released 2016-10-26
The last revision was dated 2016-11-02, with a file datestamp of 2016-10-28.
Experiment type: EM
Resolution: N/A
R-factor: N/A
AEROSPACI score: -0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: anaphase-promoting complex subunit 1
    Species: Homo sapiens [TaxId:9606]
    Gene: ANAPC1, TSG24
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Anaphase-promoting complex subunit 11
    Species: Homo sapiens [TaxId:9606]
    Gene: ANAPC11, HSPC214
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: cell division cycle protein 23 homolog
    Species: Homo sapiens [TaxId:9606]
    Gene: CDC23, ANAPC8
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: anaphase-promoting complex subunit 15
    Species: Homo sapiens [TaxId:9606]
    Gene: ANAPC15, C11ORF51, HSPC020
    Database cross-references and differences (RAF-indexed):
  • Chain 'E':
    Compound: Anaphase-promoting complex subunit 16
    Species: Homo sapiens [TaxId:9606]
    Gene: ANAPC16, C10orf104, CENP-27
    Database cross-references and differences (RAF-indexed):
  • Chain 'F':
    Compound: Cell division cycle protein 27 homolog
    Species: Homo sapiens [TaxId:9606]
    Gene: CDC27, ANAPC3, D0S1430E, D17S978E
    Database cross-references and differences (RAF-indexed):
  • Chain 'G':
    Compound: Anaphase-promoting complex subunit CDC26
    Species: Homo sapiens [TaxId:9606]
    Gene: CDC26, ANAPC12, C9ORF17
    Database cross-references and differences (RAF-indexed):
  • Chain 'H':
    Compound: Cell division cycle protein 27 homolog
    Species: Homo sapiens [TaxId:9606]
    Gene: CDC27, ANAPC3, D0S1430E, D17S978E
    Database cross-references and differences (RAF-indexed):
  • Chain 'I':
    Compound: anaphase-promoting complex subunit 4
    Species: Homo sapiens [TaxId:9606]
    Gene: ANAPC4, APC4
    Database cross-references and differences (RAF-indexed):
  • Chain 'J':
    Compound: Cell division cycle protein 16 homolog
    Species: Homo sapiens [TaxId:9606]
    Gene: CDC16, ANAPC6
    Database cross-references and differences (RAF-indexed):
  • Chain 'K':
    Compound: Cell division cycle protein 16 homolog
    Species: Homo sapiens [TaxId:9606]
    Gene: CDC16, ANAPC6
    Database cross-references and differences (RAF-indexed):
  • Chain 'L':
    Compound: anaphase-promoting complex subunit 10
    Species: Homo sapiens [TaxId:9606]
    Gene: ANAPC10, APC10
    Database cross-references and differences (RAF-indexed):
  • Chain 'M':
    Compound: anaphase-promoting complex subunit 13
    Species: Homo sapiens [TaxId:9606]
    Gene: ANAPC13
    Database cross-references and differences (RAF-indexed):
  • Chain 'N':
    Compound: Anaphase-promoting complex subunit 2
    Species: Homo sapiens [TaxId:9606]
    Gene: ANAPC2, APC2, KIAA1406
    Database cross-references and differences (RAF-indexed):
  • Chain 'O':
    Compound: anaphase-promoting complex subunit 5
    Species: Homo sapiens [TaxId:9606]
    Gene: ANAPC5, APC5
    Database cross-references and differences (RAF-indexed):
  • Chain 'P':
    Compound: cell division cycle protein 23 homolog
    Species: Homo sapiens [TaxId:9606]
    Gene: CDC23, ANAPC8
    Database cross-references and differences (RAF-indexed):
  • Chain 'R':
    Compound: fizzy-related protein homolog
    Species: Homo sapiens [TaxId:9606]
    Gene: FZR1, CDH1, FYR, FZR, KIAA1242
    Database cross-references and differences (RAF-indexed):
  • Chain 'S':
    Compound: Ubiquitin_variant-Hsl1(substrate) fusion
    Species: Saccharomyces cerevisiae (strain ATCC 204508 / S288c) [TaxId:559292]
    Gene: HSL1, YKL101W, YKL453
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0CG47 (5-End)
      • engineered mutation (8)
      • engineered mutation (12-13)
      • engineered mutation (15)
      • engineered mutation (46)
      • engineered mutation (48)
      • engineered mutation (51)
      • engineered mutation (53)
      • engineered mutation (68)
      • engineered mutation (70)
      • engineered mutation (72)
      • engineered mutation (74-75)
      • engineered mutation (77-78)
    • Uniprot P34244
  • Chain 'T':
    Compound: Ubiquitin-conjugating enzyme E2 S
    Species: Homo sapiens [TaxId:9606]
    Gene: UBE2S, E2EPF, OK/SW-cl.73
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q16763
      • conflict (121)
  • Chain 'W':
    Compound: Anaphase-promoting complex subunit CDC26
    Species: Homo sapiens [TaxId:9606]
    Gene: CDC26, ANAPC12, C9ORF17
    Database cross-references and differences (RAF-indexed):
  • Chain 'X':
    Compound: Anaphase-promoting complex subunit 7
    Species: Homo sapiens [TaxId:9606]
    Gene: ANAPC7, APC7
    Database cross-references and differences (RAF-indexed):
  • Chain 'Y':
    Compound: Anaphase-promoting complex subunit 7
    Species: Homo sapiens [TaxId:9606]
    Gene: ANAPC7, APC7
    Database cross-references and differences (RAF-indexed):

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >5l9tA (A:)
    msnfyeerttmiaardlqefvpfgrdhckhhpnalnlqlrqlqpaselwssdgaaglvgs
    lqevtihekqkeswqlrkgvseigedvdydeelyvagnmviwskgsksqalavykaftvd
    spvqqalwcdfiisqdksekayssnevekcicilqsscinmhsiegkdyiaslpfqvanv
    wptkygllfersasshevppgspreplptmfsmlhpldeitplvcksgslfgssrvqyvv
    dhamkivflntdpsivmtydavqnvhsvwtlrrvkseeenvvlkfseqggtpqnvatsss
    ltahlrslskgdspvtspfqnyssihsqsrstsspslhsrspsisnmaalsrahspalgv
    hsfsgvqrfnisshnqspkrhsishspnsnsngsflapetepivpelcidhlwtetitni
    reknsqaskvfitsdlcgqkflcflvesqlqlrcvkfqesndktqlifgsvtnipakdaa
    pvekidtmlvlegsgnlvlytgvvrvgkvfipglpapsltmsntmprpstpldgvstpkp
    lskllgsldevvllspvpelrdssklhdslynedctfqqlgtyihsirdpvhnrvtlels
    ngsmvritipeiatselvqtclqaikfilpkeiavqmlvkwynvhsapggpsyhsewnlf
    vtclmnmmgyntdrlawtrnfdfegslspviapkkarpsetgsdddweyllnsdyhqnve
    shllnrslclspseasqmkdedfsqnlsldsstllfthipaiffvlhlvyeelklntlmg
    egicslvellvqlardlklgpyvdhyyrdyptlvrttgqvctidpgqtgfmhhpsfftse
    ppsiyqwvssclkgegmppypylpgicersrlvvlsialyilgdeslvsdessqyltrit
    iapqklqveqeenrfsfrhstsvsslaerlvvwmtnvgftlrdletlpfgialpirdaiy
    hcreqpasdwpeavclligrqdlskqacegnlpkgksvlssdvpsgteteeeddgmndmn
    hevmsliwsedlrvqdvrrllqsahpvrvnvvqypelsdhefieekenrllqlcqrtmal
    pvgrgmftlfsyhpvpteplpipklnltgrapprnttvdlnsgnidvppnmtswasfhng
    vaaglkiapasqidsawivynkpkhaelaneyagflmalglnghltklatlnihdyltkg
    hemtsiglllgvsaaklgtmdmsitrllsihipallpptsteldvphnvqvaavvgiglv
    yqgtahrhtaevllaeigrppgpemeyctdresyslaaglalgmvclghgsnligmsdln
    vpeqlyqymvgghrrfqtgmhrekhkspsyqikegdtinvdvtcpgatlalamiylktnn
    rsiadwlrapdtmylldfvkpeflllrtlarclilwddilpnskwvdsnvpqiirensis
    lseielpcsedlnletlsqahvyiiagaclslgfrfagsenlsafnclhkfakdfmtyls
    apnasvtgphnletclsvvllslamvmagsgnlkvlqlcrflhmktggemnygfhlahhm
    algllflgggryslstsnssiaallcalyphfpahstdnryhlqalrhlyvlaaeprllv
    pvdvdtntpcyallevtykgtqwyeqtkeelmaptllpelhllkqikvkgprywellidl
    skgtqhlksilskdgvlyvklragqlsykedpmgwqsllaqtvanrnsearafkpetisa
    ftsdpallsfaeyfckptvnmgqkqeildlfssvlyecvtqetpemlpayiamdqairrl
    grremsetselwqiklvleffssrshqerlqnhpkrglfmnseflpvvkctidntldqwl
    qvggdmcvhaylsgqpleesqlsmlacflvyhsvpapqhlppiglegstsfaellfkfkq
    lkmpvrallrlaplllgnpqpmvm
    

    Sequence, based on observed residues (ATOM records):
    >5l9tA (A:)
    miaardlqefvpfgrdhckhhpkeswqlrkgvseigedvdydeelyvagnmviwskgsks
    qalavykaftvdspvqqalwcdfiisevekcicilqsscinmhsiegkdyiaslpfqvan
    vwptkygllfersplptmfsmlhpldeitplvckvqyvvdhamkivflntdpsivmtyda
    vqnvhsvwtlrrvksvpelcidhlwtnsqaskvfitsdlcgqkflcflvesqlqlrcvkf
    qestqlifgsvtnipakdaapvekidtmlvlegsgnlvlytgvvrvgkvfipgtyihsir
    dpvhnrvtlelsngsmvritipeiatselvqtclqaikfilpkeiavqmlvkwynvhsap
    hsewnlfvtclmnmmgydddweyllnsdyhqnveshllnrslclsthipaiffvlhlvye
    elklntlmgegicslvellvqlardlklgpyvdhyyrdyptlvseppsiyqwvssclkge
    gmppypylpgicersrlvvlsialyilsslaerlvvwmtnvgftlrdletlpfgialpir
    daiyhcreqpasdwpeavclligrqdlskqddgmndmnhevmsliwsedlrvqdvrrllq
    sahpvrvnvvqypelsdhefieekenrllqlcqrtmalpvgrgmftlfsyhpvpteplpi
    pklnltgrapprnttvdlnsgnidvppnmtswasfhngvaaglkiapasqidsawivynk
    pkhaelaneyagflmalglnghltklatlnihdyltkghemtsiglllgvsaaklgtmdm
    sitrllsihipallpptsteldvphnvqvaavvgiglvyqgtahrhtaevllaeigrppg
    pemeyctdresyslaaglalgmvclghgsnligmsdlnvpeqlyqymvgghspsyqikeg
    dtinvdvtcpgatlalamiylktnnrsiadwlrapdtmylldfvkpeflllrtlarclil
    wddilpnskwvdsnvpqiirenlnletlsqahvyiiagaclslgfrfagsenlsafnclh
    kfakdfmtylsapnasvtgphnletclsvvllslamvmagsgnlkvlqlcrflhmktgge
    mnygfhlahhmalgllflgggryslstsnssiaallcalyphfpahstdnryhlqalrhl
    yvlaaeprllvpvdvdtntpcyallevtykgtqwyeqtkeelmaptllpelhllkqikvk
    gprywellidltqhlksilskdgvlyvklragllsfaeyfclfssvlyecvtqetpemlp
    ayiamdqairrlgrremsetselwqiklvleffssrshqfmnseflpvvkctidntldqw
    lqvggdmcvhaylsleesqlsmlacflvyhsvpapstsfaellfkfkqlkmpvrallrla
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >5l9tB (B:)
    mkvkikcwngvatwlwvandencgicrmafngccpdckvpgddcplvwgqcshcfhmhci
    lkwlhaqqvqqhcpmcrqewkfke
    

    Sequence, based on observed residues (ATOM records):
    >5l9tB (B:)
    kikcwngvatwdencgicrmafngccpdcddcplvwgqcshcfhmhcilkwlhaqhcpmc
    rqewkfke
    

  • Chain 'C':
    Sequence, based on SEQRES records:
    >5l9tC (C:)
    maastsmvpvavtaavapvlsinsdfsdlreikkqllliagltrergllhsskwsaelaf
    slpalplaelqppppiteedaqdmdaytlakayfdvkeydraahflhgcnskkayflymy
    srylsgekkkddetvdslgplekgqvknealrelrvelskkhqareldgfglylygvvlr
    kldlvkeaidvfveathvlplhwgawlelcnlitdkemlkflslpdtwmkefflahiyte
    lqlieealqkyqnlidvgfskssyivsqiavayhnirdidkalsifnelrkqdpyrienm
    dtfsnllyvrsmkselsylahnlceidkyrvetccvignyyslrsqhekaalyfqralkl
    nprylgawtlmgheymemkntsaaiqayrhaievnkrdyrawyglgqtyeilkmpfycly
    yyrrahqlrpndsrmlvalgecyeklnqlveakkcywrayavgdvekmalvklaklheql
    teseqaaqcyikyiqdiyscgeivehleestafrylaqyyfkcklwdeastcaqkccafn
    dtreegkallrqilqlrnqgetpttevpapfflpaslsanntptrrvsplnlssvtp
    

    Sequence, based on observed residues (ATOM records):
    >5l9tC (C:)
    fsdlreikkqllliagltrergllhsskwsaelafslpalplaelqppppiteedaqdmd
    aytlakayfdvkeydraahflhgcnskkayflymysrylsgekkkddetvdslgplekgq
    vknealrelrvelskkhqareldgfglylygvvlrkldlvkeaidvfveathvlplhwga
    wlelcnlitdkemlkflslpdtwmkefflahiytelqlieealqkyqnlidvgfskssyi
    vsqiavayhnirdidkalsifnelrkqdpyrienmdtfsnllyvrsmkselsylahnlce
    idkyrvetccvignyyslrsqhekaalyfqralklnprylgawtlmgheymemkntsaai
    qayrhaievnkrdyrawyglgqtyeilkmpfyclyyyrrahqlrpndsrmlvalgecyek
    lnqlveakkcywrayavgdvekmalvklaklheqlteseqaaqcyikyiqdiysc
    

  • Chain 'D':
    Sequence, based on SEQRES records:
    >5l9tD (D:)
    mstlfpslfprvtetlwfnldrpcveetelqqqeqqhqawlqsiaekdnnlvpigkpase
    hyddeeeeddeddedseedseddedmqdmdemndynespddgevnevdmegneqdqdqwm
    i
    

    Sequence, based on observed residues (ATOM records):
    >5l9tD (D:)
    stlfpslfprvtetlwfnldrpcveetelqqqeqqhqawlqsiaekdnnlvpigk
    

  • Chain 'E':
    Sequence, based on SEQRES records:
    >5l9tE (E:)
    maassssssaggvsgssvtgsgfsvsdlapprkalftypkgagemledgserflcesvfs
    yqvastlkqvkhdqqvarmeklaglveeleadewrfkpieqllgftpssg
    

    Sequence, based on observed residues (ATOM records):
    >5l9tE (E:)
    rflcesvfsyqvastlkqvkhdqqvarmeklaglveeleadewrfkpieqllgftp
    

  • Chain 'F':
    Sequence, based on SEQRES records:
    >5l9tF (F:)
    mtvlqepvqaaiwqalnhyayrdavflaerlyaevhseealfllatcyyrsgkaykayrl
    lkghscttpqckyllakccvdlsklaegeqilsggvfnkqkshddivtefgdsacftlsl
    lghvycktdrlakgsecyqkslslnpflwspfeslceigekpdpdqtfkftslqnfsncl
    pnscttqvpnhslshrqpetvltetpqdtielnrlnlessnskyslntdssvsyidsavi
    spdtvplgtgtsilskqvqnkpktgrsllggpaalspltpsfgilpletpspgdgsylqn
    ytntppvidvpstgapskksvarigqtgtksvfsqsgnsrevtpilaqtqssgpqtsttp
    qvlsptitsppnalprrssrlftsdssttkenskklkmkfppkipnrktksktnkggitq
    pnindsleitkldssiisegkistitpqiqafnlqkaaaeglmsllremgkgylalcsyn
    ckeainilshlpshhyntgwvlcqigrayfelseymqaerifsevrrienyrvegmeiys
    ttlwhlqkdvalsvlskdltdmdknspeawcaagncfslqrehdiaikffqraiqvdpny
    ayaytllghefvlteeldkalacfrnairvnprhynawyglgmiyykqekfslaemhfqk
    aldinpqssvllchigvvqhalkksekaldtlnkaividpknplckfhrasvlfanekyk
    salqeleelkqivpkeslvyfligkvykklgqthlalmnfswamdldpkgannqikeaid
    krylpddeepitqeeqimgtdesqessmtdaddtqlhaaesdef
    

    Sequence, based on observed residues (ATOM records):
    >5l9tF (F:)
    qepvqaaiwqalnhyayrdavflaerlyaevhseealfllatcyyrsgkaykayrllkgh
    scttpqckyllakccvdlsklaegeqilsggvfnkqkshddivtefgdsacftlsllghv
    ycktdrlakgsecyqkslslnpflwspfeslceigekpdpdqtfkfafnlqkaaaeglms
    llremgkgylalcsynckeainilshlpshhyntgwvlcqigrayfelseymqaerifse
    vrrienyrvegmeiysttlwhlqkdvalsvlskdltdmdknspeawcaagncfslqrehd
    iaikffqraiqvdpnyayaytllghefvlteeldkalacfrnairvnprhynawyglgmi
    yykqekfslaemhfqkaldinpqssvllchigvvqhalkksekaldtlnkaividpknpl
    ckfhrasvlfanekyksalqeleelkqivpkeslvyfligkvykklgqthlalmnfswam
    dl
    

  • Chain 'G':
    Sequence, based on SEQRES records:
    >5l9tG (G:)
    mlrrkptrlelklddieefenirkdletrkkqkedvevvggsdgegaiglssdpksreqm
    indrigykpqpkpnnrssqfgslef
    

    Sequence, based on observed residues (ATOM records):
    >5l9tG (G:)
    mlrrkptrlelklddieefenirkd
    

  • Chain 'H':
    Sequence, based on SEQRES records:
    >5l9tH (H:)
    mtvlqepvqaaiwqalnhyayrdavflaerlyaevhseealfllatcyyrsgkaykayrl
    lkghscttpqckyllakccvdlsklaegeqilsggvfnkqkshddivtefgdsacftlsl
    lghvycktdrlakgsecyqkslslnpflwspfeslceigekpdpdqtfkftslqnfsncl
    pnscttqvpnhslshrqpetvltetpqdtielnrlnlessnskyslntdssvsyidsavi
    spdtvplgtgtsilskqvqnkpktgrsllggpaalspltpsfgilpletpspgdgsylqn
    ytntppvidvpstgapskksvarigqtgtksvfsqsgnsrevtpilaqtqssgpqtsttp
    qvlsptitsppnalprrssrlftsdssttkenskklkmkfppkipnrktksktnkggitq
    pnindsleitkldssiisegkistitpqiqafnlqkaaaeglmsllremgkgylalcsyn
    ckeainilshlpshhyntgwvlcqigrayfelseymqaerifsevrrienyrvegmeiys
    ttlwhlqkdvalsvlskdltdmdknspeawcaagncfslqrehdiaikffqraiqvdpny
    ayaytllghefvlteeldkalacfrnairvnprhynawyglgmiyykqekfslaemhfqk
    aldinpqssvllchigvvqhalkksekaldtlnkaividpknplckfhrasvlfanekyk
    salqeleelkqivpkeslvyfligkvykklgqthlalmnfswamdldpkgannqikeaid
    krylpddeepitqeeqimgtdesqessmtdaddtqlhaaesdef
    

    Sequence, based on observed residues (ATOM records):
    >5l9tH (H:)
    qepvqaaiwqalnhyayrdavflaerlyaevhseealfllatcyyrsgkaykayrllkgh
    scttpqckyllakccvdlsklaegeqilsggvfnkqkshddivtefgdsacftlsllghv
    ycktdrlakgsecyqkslslnpflwspfeslceigekpdpdqtfkfafnlqkaaaeglms
    llremgkgylalcsynckeainilshlpshhyntgwvlcqigrayfelseymqaerifse
    vrrienyrvegmeiysttlwhlqkdvalsvlskdltdmdknspeawcaagncfslqrehd
    iaikffqraiqvdpnyayaytllghefvlteeldkalacfrnairvnprhynawyglgmi
    yykqekfslaemhfqkaldinpqssvllchigvvqhalkksekaldtlnkaividpknpl
    ckfhrasvlfanekyksalqeleelkqivpkeslvyfligkvykklgqthlalmnfswam
    dld
    

  • Chain 'I':
    Sequence, based on SEQRES records:
    >5l9tI (I:)
    mlrfptcfpsfrvvgekqlpqeiiflvwspkrdlialantagevllhrlasfhrvwsfpp
    nentgkevtclawrpdgkllafaladtkkivlcdvekpeslhsfsveapvscmhwmevtv
    essvltsfynaedesnlllpklptlpknysntskifseensdeiikllgdvrlnilvlgg
    ssgfielyaygmfkiarvtgiagtclalclssdlkslsvvtevstngasevsyfqletnl
    lysflpevtrmarkfthisallqyinlsltcmceaweeilmqmdsrltkfvqekntttsv
    qdefmhlllwgkasaelqtllmnqltvkglkklgqsiessyssiqklvishlqsgsesll
    yhlselkgmaswkqkyeplgldaagieeaitavgsfilkanellqvidssmknfkaffrw
    lyvamlrmtedhvlpelnkmtqkditfvaefltehfneapdlynrkgkyfnvervgqylk
    dedddlvsppntegnqwydflqnsshlkespllfpyyprkslhfvkrrmeniidqclqkp
    advigksmnqaiciplyrdtrsedstrrlfkfpflwnnktsnlhyllftiledslykmci
    lrrhtdisqsvsngliaikfgsftyattekvrrsiyscldaqfyddetvtvvlkdtvgre
    grdrllvqlplslvynsedsaeyqftgtystrldeqcsaiptrtmhfekhwrllesmkaq
    yvagngfrkvscvlssnlrhvrvfemdiddeweldessdeeeeasnkpvkikeevlsese
    aenqqagaaalapeivikvekldpeldsggslevlfqg
    

    Sequence, based on observed residues (ATOM records):
    >5l9tI (I:)
    tcfpsfrvvgekqlpqeiiflvwspkrdlialantagevllhrlasfhrvwsfppnentg
    kevtclawrpdgkllafaladtkkivlcdvekpeslhsfsveapvscmhwmevtvessvl
    tsfyedesnlllpklptlpknysntskifseensdeiikllgdvrlnilvlggssgfiel
    yaygmfkiarvtgiagtclalclssdlkslsvvtevstngasevsyfqletnllysflpe
    vtrmarkfthisallqyinlsltcmceaweeilmqmdsrltkfvqekntttsvqdefmhl
    llwgkasaelqtllmnqltvkglkklgqsiessyssiqklvishlqsgsesllyhlselk
    gmaswkqkyeplgldaagieeaitavgsfilkanellqvidssmknfkaffrwlyvamlr
    mtekmtqkditfvaefltehfnfnvervgqylkdedddlvsppntegnqwydflqnsshl
    kespllfpyyprkslhfvkrrmeniidqclqkpadvigksmnqaiciplyrdtrsedstr
    rlfkfpflwnnktsnlhyllftiledslykmcilrrhtdisqsvsngliaikfgsftyat
    tekvrrsiyscldaqfyddetvtvvlkdtvgregrdrllvqlplslvynsedsaeyqftg
    tystrldeqcsaiptrtmhfekhwrllesmkaqyvagngfrkvscvlssnlrhvrvfemd
    iddewel
    

  • Chain 'J':
    Sequence, based on SEQRES records:
    >5l9tJ (J:)
    mnlerlrkrvrqyldqqqyqsalfwadkvaslsreepqdiywlaqclyltaqyhraahal
    rsrkldklyeacrylaarchyaakehqqaldvldmeepinkrlfekylkdesgfkdpssd
    wemsqssikssicllrgkiydaldnrtlatysykealkldvycfeafdlltshhmltaqe
    ekelleslplsklcneeqellrflfenklkkynkpsetvipesvdglqenldvvvslaer
    hyyncdfkmcykltsvvmekdpfhasclpvhigtlvelnkanelfylshklvdlypsnpv
    swfavgcyylmvghkneharrylskattlektygpawiayghsfavesehdqamaayfta
    aqlmkgchlpmlyigleygltnnsklaerffsqalsiapedpfvmhevgvvafqngewkt
    aekwfldalekikaignevtvdkwepllnnlghvcrklkkyaealdyhrqalvlipqnas
    tysaigyihslmgnfenavdyfhtalglrrddtfsvtmlghciemyigdseayigadikd
    klkcydfdvhtmktlkniisppwdfrefevekqtaeetgltpletsrktpdsrpsleetf
    eiemnesdmmletsmsdhst
    

    Sequence, based on observed residues (ATOM records):
    >5l9tJ (J:)
    nlerlrkrvrqyldqqqyqsalfwadkvaslsreepqdiywlaqclyltaqyhraahalr
    srkldklyeacrylaarchyaakehqqaldvldmsqssikssicllrgkiydaldnrtla
    tysykealkldvycfeafdlltshhmltaqeekelleslplsklcneeqellrflfenkl
    kkynkpsetvipesvdglqenldvvvslaerhyyncdfkmcykltsvvmekdpfhasclp
    vhigtlvelnkanelfylshklvdlypsnpvswfavgcyylmvghkneharrylskattl
    ektygpawiayghsfavesehdqamaayftaaqlmkgchlpmlyigleygltnnsklaer
    ffsqalsiapedpfvmhevgvvafqngewktaekwfldalekikaignevtvdkweplln
    nlghvcrklkkyaealdyhrqalvlipqnastysaigyihslmgnfenavdyfhtalglr
    rddtfsvtmlghciemyigdseay
    

  • Chain 'K':
    Sequence, based on SEQRES records:
    >5l9tK (K:)
    mnlerlrkrvrqyldqqqyqsalfwadkvaslsreepqdiywlaqclyltaqyhraahal
    rsrkldklyeacrylaarchyaakehqqaldvldmeepinkrlfekylkdesgfkdpssd
    wemsqssikssicllrgkiydaldnrtlatysykealkldvycfeafdlltshhmltaqe
    ekelleslplsklcneeqellrflfenklkkynkpsetvipesvdglqenldvvvslaer
    hyyncdfkmcykltsvvmekdpfhasclpvhigtlvelnkanelfylshklvdlypsnpv
    swfavgcyylmvghkneharrylskattlektygpawiayghsfavesehdqamaayfta
    aqlmkgchlpmlyigleygltnnsklaerffsqalsiapedpfvmhevgvvafqngewkt
    aekwfldalekikaignevtvdkwepllnnlghvcrklkkyaealdyhrqalvlipqnas
    tysaigyihslmgnfenavdyfhtalglrrddtfsvtmlghciemyigdseayigadikd
    klkcydfdvhtmktlkniisppwdfrefevekqtaeetgltpletsrktpdsrpsleetf
    eiemnesdmmletsmsdhst
    

    Sequence, based on observed residues (ATOM records):
    >5l9tK (K:)
    nlerlrkrvrqyldqqqyqsalfwadkvaslsreepqdiywlaqclyltaqyhraahalr
    srkldklyeacrylaarchyaakehqqaldvlsikssicllrgkiydaldnrtlatysyk
    ealkldvycfeafdlltshhmltaqeekelleslplsklcneeqellrflfenklkkynk
    psetvipesvdglqenldvvvslaerhyyncdfkmcykltsvvmekdpfhasclpvhigt
    lvelnkanelfylshklvdlypsnpvswfavgcyylmvghkneharrylskattlektyg
    pawiayghsfavesehdqamaayftaaqlmkgchlpmlyigleygltnnsklaerffsqa
    lsiapedpfvmhevgvvafqngewktaekwfldalekikaignevtvdkwepllnnlghv
    crklkkyaealdyhrqalvlipqnastysaigyihslmgnfenavdyfhtalglrrddtf
    svtmlghciemyi
    

  • Chain 'L':
    Sequence, based on SEQRES records:
    >5l9tL (L:)
    mttpnktppgadpkqlertgtvreigsqavwslssckpgfgvdqlrddnletywqsdgsq
    phlvniqfrrkttvktlciyadyksdesytpskisvrvgnnfhnlqeirqlelvepsgwi
    hvpltdnhkkptrtfmiqiavlanhqngrdthmrqikiytpveessigkfprcttidfmm
    yrsir
    

    Sequence, based on observed residues (ATOM records):
    >5l9tL (L:)
    adpkqlertgtvreigsqavwslssckpgfgvdqlrddnletywqsdgsqphlvniqfrr
    kttvktlciyadyksdesytpskisvrvgnnfhnlqeirqlelvepsgwihvpltdnhkk
    ptrtfmiqiavlanhqngrdthmrqikiytpvekfprcttidfmmyrsir
    

  • Chain 'M':
    Sequence, based on SEQRES records:
    >5l9tM (M:)
    mdsevqrdgrildliddawredklpyedvaiplnelpepeqdnggttesvkeqemkwtdl
    alqylhenvppign
    

    Sequence, based on observed residues (ATOM records):
    >5l9tM (M:)
    mdsevqrdgrildliddawredklpyedvaiwtdlalqylhe
    

  • Chain 'N':
    Sequence, based on SEQRES records:
    >5l9tN (N:)
    maaavvvaegdsdsrpgqellvawntvstglvppaalglvssrtsgavppkeeelraave
    vlrghglhsvleewfvevlqndlqanispefwnaisqcensadepqcllllldafglles
    rldpylrslellekwtrlgllmgtgaqglreevhtmlrgvlffstprtfqemiqrlygcf
    lrvymqskrkgeggtdpelegeldsryarrryyrllqsplcagcssdkqqcwcrqaleqf
    hqlsqvlhrlsllervsaeavtttlhqvtrermedrcrgeyersflrefhkwiervvgwl
    gkvflqdgparpaspeagntlrrwrchvqrffyriyaslrieelfsivrdfpdsrpaied
    lkyclertdqrqqllvslkaaletrllhpgvntcdiitlyisaikalrvldpsmvileva
    cepirrylrtredtvrqivagltgdsdgtgdlavelsktdpasletgqdseddsgepedw
    vpdpvdadpgkssskrrssdiisllvsiygskdlfineyrslladrllhqfsfspereir
    nvellklrfgeapmhfcevmlkdmadsrrinanireedekrpaeeqppfgvyavilssef
    wppfkdeklevpediraaleayckkyeqlkamrtlswkhtlglvtmdveladrtlsvavt
    pvqavillyfqdqaswtleelskavkmpvallrrrmsvwlqqgvlreeppgtfsvieeer
    pqdrdnmvlidsddesdsgmasqadqkeeelllfwtyiqamltnleslsldriynmlrmf
    vvtgpalaeidlqelqgylqkkvrdqqlvysagvyrlpkncs
    

    Sequence, based on observed residues (ATOM records):
    >5l9tN (N:)
    gqellvawntvsteelraavevlrghvleewfvevlqndlqanispefwnaisqcensac
    llllldafgllesrldpylrslellekwtrlgllmglreevhtmlrgvlffstprtfqem
    iqrlygcflrvymqskrkwcrqaleqfhqlsqvlhrlsllervsaeavtttlhqvtrerm
    edrcrgeyersflrefhkwiervvgwlgkvftlrrwrchvqrffyriyaslrieelfsiv
    rdfpdsrpaiedlkyclertdqrqqllvslkaaletrllhpgvntcdiitlyisaikalr
    vldpsmvilevacepirrylrtredtvrqivagltdlavelskssdiisllvsiydlfin
    eyrslladrllhqfsfspereirnvellklrfgeapmhfcevmlkdmadsrrinaniree
    dekrpaeeqppfgvyavilssefwppfkdeklevpediraaleayckkyeqlswkhtlgl
    vtmdvtpvqavillyfqdqaswtleelskavkmpvallrrrmsvwlqqgvlreeppgtfs
    vieeer
    

  • Chain 'O':
    Sequence, based on SEQRES records:
    >5l9tO (O:)
    masvheslyfnpmmtngvvhanvfgikdwvtpykiavlvllnemsrtgegavslmerrrl
    nqlllpllqgpditlsklyklieescpqlansvqiriklmaegelkdmeqffddlsdsfs
    gtepevhktsvvglflrhmilaysklsfsqvfklytalqqyfqngekktvedadmeltsr
    degerkmekeeldvsvreeevscsgplsqkqaefflsqqasllkndetkaltpaslqkel
    nnllkfnpdfaeahylsylnnlrvqdvfssthsllhyfdrliltgaesksngeegygrsl
    ryaalnlaalhcrfghyqqaelalqeairiaqesndhvclqhclswlyvlgqkrsdsyvl
    lehsvkkavhfglpylaslgiqslvqqrafagktanklmdalkdsdllhwkhslselidi
    siaqktaiwrlygrstmalqqaqmllsmnsleavnagvqqnntesfavalchlaelhaeq
    gcfaaasevlkhlkerfppnsqhaqlwmlcdqkiqfdramndgkyhladslvtgitalns
    iegvyrkavvlqaqnqmseahkllqkllvhcqklkntemvisvllsvaelywrsssptia
    lpmllqalalskeyrlqylasetvlnlafaqlilgipeqalsllhmaiepiladgaildk
    gramflvakcqvasaasydqpkkaealeaaienlneaknyfakvdckerirdvvyfqarl
    yhtlgktqernrcamlfrqlhqelpshgvplinhl
    

    Sequence, based on observed residues (ATOM records):
    >5l9tO (O:)
    kdwvtpykiavlvllnemsrtgegavslmerrrlnqlllpllqgpditlsklyklieesc
    pqlansvqiriklmaegelkdmeqffddlsdsfsgtepevhktsvvglflrhmilayskl
    sfsqvfklytalqqyfqngekktplsqkqaefflsqqasllkndetkaltpaslqkelnn
    llkfnpdfaeahylsylnnlrvqdvfssthsllhyfdrliltgaesksngeegygrslry
    aalnlaalhcrfghyqqaelalqeairiaqesndhvclqhclswlyvlgqkrsdsyvlle
    hsvkkavhfglpylaslgiqslvqqrafagktanklmdalkdsdllhwkhslselidisi
    aqktaiwrlygrstmalqqaqmllsmnsleqqnntesfavalchlaelhaeqgcfaaase
    vlkhlkerfppnsqhaqlwmlcdqkiqfdramndgkyhladslvtgitalnsiegvyrka
    vvlqaqnqmseahkllqkllvhcqklkntemvisvllsvaelywrsssptialpmllqal
    alskeyrlqylasetvlnlafaqlilgipeqalsllhmaiepiladgaildkgramflva
    kcqvasaasydqpkkaealeaaienlneaknyfakvdckerirdvvyfqarlyhtlgktq
    ernrcamlfrqlhqelpsvplinhl
    

  • Chain 'P':
    Sequence, based on SEQRES records:
    >5l9tP (P:)
    maastsmvpvavtaavapvlsinsdfsdlreikkqllliagltrergllhsskwsaelaf
    slpalplaelqppppiteedaqdmdaytlakayfdvkeydraahflhgcnskkayflymy
    srylsgekkkddetvdslgplekgqvknealrelrvelskkhqareldgfglylygvvlr
    kldlvkeaidvfveathvlplhwgawlelcnlitdkemlkflslpdtwmkefflahiyte
    lqlieealqkyqnlidvgfskssyivsqiavayhnirdidkalsifnelrkqdpyrienm
    dtfsnllyvrsmkselsylahnlceidkyrvetccvignyyslrsqhekaalyfqralkl
    nprylgawtlmgheymemkntsaaiqayrhaievnkrdyrawyglgqtyeilkmpfycly
    yyrrahqlrpndsrmlvalgecyeklnqlveakkcywrayavgdvekmalvklaklheql
    teseqaaqcyikyiqdiyscgeivehleestafrylaqyyfkcklwdeastcaqkccafn
    dtreegkallrqilqlrnqgetpttevpapfflpaslsanntptrrvsplnlssvtp
    

    Sequence, based on observed residues (ATOM records):
    >5l9tP (P:)
    fsdlreikkqllliagltrergllhsskwsaelafslpalplaelqppppiteedaqdmd
    aytlakayfdvkeydraahflhgcnskkayflymysrylsgekkkddetknealrelrve
    lskkhqareldgfglylygvvlrkldlvkeaidvfveathvlplhwgawlelcnlitdke
    mlkflslpdtwmkefflahiytelqlieealqkyqnlidvgfskssyivsqiavayhnir
    didkalsifnelrkqdpyrienmdtfsnllyvrsmkselsylahnlceidkyrvetccvi
    gnyyslrsqhekaalyfqralklnprylgawtlmgheymemkntsaaiqayrhaievnkr
    dyrawyglgqtyeilkmpfyclyyyrrahqlrpndsrmlvalgecyeklnqlveakkcyw
    rayavgdvekmalvklaklheql
    

  • Chain 'R':
    Sequence, based on SEQRES records:
    >5l9tR (R:)
    mdqdyerrllrqiviqnentmprvtemrrtltpasspvsspskhgdrfipsraganwsvn
    fhrinenekspsqnrkakdatsdngkdglaysallknellgagiekvqdpqtedrrlqps
    tpekkglftyslstkrsspddgndvspyslspvsnksqkllrsprkptrkiskipfkvld
    apelqddfylnlvdwsslnvlsvglgtcvylwsactsqvtrlcdlsvegdsvtsvgwser
    gnlvavgthkgfvqiwdaaagkklsmleghtarvgalawnaeqlssgsrdrmilqrdirt
    pplqserrlqghrqevcglkwstdhqllasggndnkllvwnhsslspvqqytehlaavka
    iawsphqhgllasgggtadrcirfwntltgqplqcidtgsqvcnlawskhanelvsthgy
    sqnqilvwkypsltqvakltghsyrvlylamspdgeaivtgagdetlrfwnvfsktrstk
    esvsvlnlftrir
    

    Sequence, based on observed residues (ATOM records):
    >5l9tR (R:)
    skhgdrfipsraganwsvnfhrinenglaysallknellgagiekvqkglftyslspysl
    spvsnksqkllrsskipfkvldapelqddfylnlvdwsslnvlsvglgtcvylwsactsq
    vtrlcdlsvegdsvtsvgwsergnlvavgthkgfvqiwdaaagkklsmleghtarvgala
    wnaeqlssgsrdrmilqrdirtpplqserrlqghrqevcglkwstdhqllasggndnkll
    vwnhsslspvqqytehlaavkaiawsphqhgllasgggtadrcirfwntltgqplqcidt
    gsqvcnlawskhanelvsthgysqnqilvwkypsltqvakltghsyrvlylamspdgeai
    vtgagdetlrfwnvvsvlnlftrir
    

  • Chain 'S':
    Sequence, based on SEQRES records:
    >5l9tS (S:)
    gsggsmqilvktprgctitlevepsdtienvkakiqdkegippdqqilffavkrledgrt
    lsdyniqkksslllamrvpgkmkssyleeqkpkraalsditnsfnkmn
    

    Sequence, based on observed residues (ATOM records):
    >5l9tS (S:)
    mqilvktprgctitlevepsdtienvkakiqdkegippdqqilffavkrledgrtlsdyn
    iqkksslllamrvpraalsditns
    

  • Chain 'T':
    Sequence, based on SEQRES records:
    >5l9tT (T:)
    gpgsmnsnvenlpphiirlvykevttltadppdgikvfpneedltdlqvtiegpegtpya
    gglfrmklllgkdfpasppkgyfltkifhpnvgangeicvnvlkrdwtaelgirhvllti
    kfllihpnpesalneeagrlllenyeeyaararllteihggaggerdkklaakkktdkkr
    alrrl
    

    Sequence, based on observed residues (ATOM records):
    >5l9tT (T:)
    tiegpegtpyagglfrmkllppkgyfltkifhpnvgangeicvnvlkrdirhvlltikfl
    lihpnpesalneeagrlllenyeeyaararllteihg
    

  • Chain 'W':
    Sequence, based on SEQRES records:
    >5l9tW (W:)
    mlrrkptrlelklddieefenirkdletrkkqkedvevvggsdgegaiglssdpksreqm
    indrigykpqpkpnnrssqfgslef
    

    Sequence, based on observed residues (ATOM records):
    >5l9tW (W:)
    mlrrkptrlelklddieefenirkd
    

  • Chain 'X':
    Sequence, based on SEQRES records:
    >5l9tX (X:)
    mnvidhvrdmaaaglhsnvrllssllltmsnnnpelfsppqkyqllvyhadslfhdkeyr
    navskytmalqqkkalsktskvrpstgnsastpqsqclpseievkykmaecytmlkqdkd
    aiaildgipsrqrtpkinmmlanlykkagqerpsvtsykevlrqcplaldailgllslsv
    kgaevasmtmnviqtvpnldwlsvwikayafvhtgdnsraisticslekksllrdnvdll
    gsladlyfragdnknsvlkfeqaqmldpylikgmdvygyllaregrledvenlgcrlfni
    sdqhaepwvvsgchsfyskrysralylgakaiqlnsnsvqalllkgaalrnmgrvqeaii
    hfreairlapcrldcyegliecylasnsireamvmannvyktlganaqtltllatvcled
    pvtqekaktlldkaltqrpdyikavvkkaellsreqkyedgiallrnalanqsdcvlhri
    lgdflvavneyqeamdqysialsldpndqkslegmqkmekeesptdatqeedvddmegsg
    eegdlegsdseaaqwadqeqwfgmq
    

    Sequence, based on observed residues (ATOM records):
    >5l9tX (X:)
    nvidhvrdmaaaglhsnvrllssllltmsnnnpelfsppqkyqllvyhadslfhdkeyrn
    avskytmalqqkkallpseievkykmaecytmlkqdkdaiaildgipsrqrtpkinmmla
    nlykkagqerpsvtsykevlrqcplaldailgllslsvkgaevasmtmnviqtvpnldwl
    svwikayafvhtgdnsraisticslekksllrdnvdllgsladlyfragdnknsvlkfeq
    aqmldpylikgmdvygyllaregrledvenlgcrlfnisdqhaepwvvsgchsfyskrys
    ralylgakaiqlnsnsvqalllkgaalrnmgrvqeaiihfreairlapcrldcyegliec
    ylasnsireamvmannvyktlganaqtltllatvcle
    

  • Chain 'Y':
    Sequence, based on SEQRES records:
    >5l9tY (Y:)
    mnvidhvrdmaaaglhsnvrllssllltmsnnnpelfsppqkyqllvyhadslfhdkeyr
    navskytmalqqkkalsktskvrpstgnsastpqsqclpseievkykmaecytmlkqdkd
    aiaildgipsrqrtpkinmmlanlykkagqerpsvtsykevlrqcplaldailgllslsv
    kgaevasmtmnviqtvpnldwlsvwikayafvhtgdnsraisticslekksllrdnvdll
    gsladlyfragdnknsvlkfeqaqmldpylikgmdvygyllaregrledvenlgcrlfni
    sdqhaepwvvsgchsfyskrysralylgakaiqlnsnsvqalllkgaalrnmgrvqeaii
    hfreairlapcrldcyegliecylasnsireamvmannvyktlganaqtltllatvcled
    pvtqekaktlldkaltqrpdyikavvkkaellsreqkyedgiallrnalanqsdcvlhri
    lgdflvavneyqeamdqysialsldpndqkslegmqkmekeesptdatqeedvddmegsg
    eegdlegsdseaaqwadqeqwfgmq
    

    Sequence, based on observed residues (ATOM records):
    >5l9tY (Y:)
    nvidhvrdmaaaglhsnvrllssllltmsnnnpelfsppqkyqllvyhadslfhdkeyrn
    avskytmalqqkkallpseievkykmaecytmlkqdkdaiaildgipsrqrtpkinmmla
    nlykkagqerpsvtsykevlrqcplaldailgllslsvkgaevasmtmnviqtvpnldwl
    svwikayafvhtgdnsraisticslekksllrdnvdllgsladlyfragdnknsvlkfeq
    aqmldpylikgmdvygyllaregrledvenlgcrlfnisdqhaepwvvsgchsfyskrys
    ralylgakaiqlnsnsvqalllkgaalrnmgrvqeaiihfreairlapcrldcyegliec
    ylasnsireamvmannvyktlganaqtltllatvcledpvtqekaktlldkaltqr