PDB entry 5l9s

View 5l9s on RCSB PDB site
Description: Structure of Agrobacterium tumefaciens C58 strain PBP AttC in open unliganded conformation
Class: transport protein
Keywords: periplasmic binding protein ABC transporter, transport protein
Deposited on 2016-06-10, released 2016-09-21
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-11-16, with a file datestamp of 2016-11-11.
Experiment type: XRAY
Resolution: 2.49 Å
R-factor: N/A
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ABC transporter, substrate binding protein (Mannopine)
    Species: Agrobacterium fabrum (strain C58 / ATCC 33970) [TaxId:176299]
    Gene: attC, Atu5129
    Database cross-references and differences (RAF-indexed):
    • Uniprot A9CLM6 (1-325)
      • initiating methionine (0)
    Domains in SCOPe 2.07: d5l9sa_
  • Chain 'B':
    Compound: ABC transporter, substrate binding protein (Mannopine)
    Species: Agrobacterium fabrum (strain C58 / ATCC 33970) [TaxId:176299]
    Gene: attC, Atu5129
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5l9sb_
  • Heterogens: ACT, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5l9sA (A:)
    meqrvviattggtyekalreawfepftkatgikvvtvsgtdaekrakvtamvqtgnvtwd
    lyldgeiqagsdahfaitedlsdfcmqfinstdlladsctrggaklqststllayklnen
    gsnpqtwadmwdlakfpgarsfpnfddpwrvlaaalladgvpreklfpldvdrafrklde
    lrdsvqvwwrtgdqsvqafrndeyrvgqiwltrakalkaegykigwsydgaflvgdrial
    vrgapnrenalkliefwlrnpaaqakacetlsctppsqkaisqmssearatlpsaadven
    riivpdaqwinanmgmlvqrwnswirhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5l9sA (A:)
    meqrvviattggtyekalreawfepftkatgikvvtvsgtdaekrakvtamvqtgnvtwd
    lyldgeiqagsdahfaitedlsdfcmqfinstdlladsctrggaklqststllayklnen
    gsnpqtwadmwdlakfpgarsfpnfddpwrvlaaalladgvpreklfpldvdrafrklde
    lrdsvqvwwrtgdqsvqafrndeyrvgqiwltrakalkaegykigwsydgaflvgdrial
    vrgapnrenalkliefwlrnpaaqakacetlsctppsqkaisqmssearatlpsaadven
    riivpdaqwinanmgmlvqrwnswir
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5l9sB (B:)
    meqrvviattggtyekalreawfepftkatgikvvtvsgtdaekrakvtamvqtgnvtwd
    lyldgeiqagsdahfaitedlsdfcmqfinstdlladsctrggaklqststllayklnen
    gsnpqtwadmwdlakfpgarsfpnfddpwrvlaaalladgvpreklfpldvdrafrklde
    lrdsvqvwwrtgdqsvqafrndeyrvgqiwltrakalkaegykigwsydgaflvgdrial
    vrgapnrenalkliefwlrnpaaqakacetlsctppsqkaisqmssearatlpsaadven
    riivpdaqwinanmgmlvqrwnswirhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5l9sB (B:)
    eqrvviattggtyekalreawfepftkatgikvvtvsgtdaekrakvtamvqtgnvtwdl
    yldgeiqagsdahfaitedlsdfcmqfinstdlladsctrggaklqststllayklneng
    snpqtwadmwdlakfpgarsfpnfddpwrvlaaalladgvpreklfpldvdrafrkldel
    rdsvqvwwrtgdqsvqafrndeyrvgqiwltrakalkaegykigwsydgaflvgdrialv
    rgapnrenalkliefwlrnpaaqakacetlsctppsqkaisqmssearatlpsaadvenr
    iivpdaqwinanmgmlvqrwnswir