PDB entry 5l9n

View 5l9n on RCSB PDB site
Description: Structure of uridylylated GlnB from Escherichia coli bound to ATP
Class: signaling protein
Keywords: Uridylylation, PII protein, nitrogen metabolism, GlnK, SIGNALING PROTEIN
Deposited on 2016-06-10, released 2017-04-05
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-05-24, with a file datestamp of 2017-05-19.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: N/A
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Nitrogen regulatory protein P-II 1
    Species: Escherichia coli (strain K12) [TaxId:83333]
    Gene: glnB, b2553, JW2537
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5l9na_
  • Heterogens: ATP, MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5l9nA (A:)
    mkkidaiikpfklddvrealaevgitgmtvtevkgfgrqkghtelyrgaeymvdflpkvk
    ieivvpddivdtcvdtiirtaqtgkigdgkifvfdvarvirirtgeeddaai
    

    Sequence, based on observed residues (ATOM records): (download)
    >5l9nA (A:)
    mkkidaiikpfklddvrealaevgitgmtvtevkgfdflpkvkieivvpddivdtcvdti
    irtaqtgkigdgkifvfdvarvirirtgeedd