PDB entry 5l9i

View 5l9i on RCSB PDB site
Description: crystal structure of the periplasmic binding protein mota in complex with dfg from a. tumefaciens b6
Deposited on 2016-06-10, released 2016-09-21
The last revision was dated 2017-09-06, with a file datestamp of 2017-09-01.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: N/A
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: periplasmic binding protein
    Species: Agrobacterium tumefaciens str. B6 [TaxId:1183423]
    Gene: ASB65_13110
    Database cross-references and differences (RAF-indexed):
    • Uniprot A0A109C781 (21-344)
      • expression tag (19-20)
  • Chain 'B':
    Compound: periplasmic binding protein
    Species: Agrobacterium tumefaciens str. B6 [TaxId:1183423]
    Gene: ASB65_13110
    Database cross-references and differences (RAF-indexed):
    • Uniprot A0A109C781 (21-End)
      • expression tag (19-20)
  • Heterogens: SNW, PEG, EDO, CA, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >5l9iA (A:)
    mgsshhhhhhssglvprgshmdvviassgggwqeaqdkalwapaakalnitytqdtfqnw
    aearaqvesgsvtwdiiqigiadepqakaagvlekldpdivnkadfppgsvtdsfvansn
    ystliawnkktygdngpksmadffdvkkfpgkralwnqpigmieaaalalgtprdkvyef
    lsteegrkaaiakltelapsvsvwwesgaqaaqlikdgevdmiitwggrvqgaindganf
    aytfndaqlgtdgyaivkgaphrdaamrflkemskaeyqkdlpnsfatapanmkaydlak
    ytpekmatmasapenvavqysvdpnfwakhakwaseaydnvrlsrhhhhhh
    

    Sequence, based on observed residues (ATOM records):
    >5l9iA (A:)
    hmdvviassgggwqeaqdkalwapaakalnitytqdtfqnwaearaqvesgsvtwdiiqi
    giadepqakaagvlekldpdivnkadfppgsvtdsfvansnystliawnkktygdngpks
    madffdvkkfpgkralwnqpigmieaaalalgtprdkvyeflsteegrkaaiakltelap
    svsvwwesgaqaaqlikdgevdmiitwggrvqgaindganfaytfndaqlgtdgyaivkg
    aphrdaamrflkemskaeyqkdlpnsfatapanmkaydlakytpekmatmasapenvavq
    ysvdpnfwakhakwaseaydnvrlsr
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >5l9iB (B:)
    mgsshhhhhhssglvprgshmdvviassgggwqeaqdkalwapaakalnitytqdtfqnw
    aearaqvesgsvtwdiiqigiadepqakaagvlekldpdivnkadfppgsvtdsfvansn
    ystliawnkktygdngpksmadffdvkkfpgkralwnqpigmieaaalalgtprdkvyef
    lsteegrkaaiakltelapsvsvwwesgaqaaqlikdgevdmiitwggrvqgaindganf
    aytfndaqlgtdgyaivkgaphrdaamrflkemskaeyqkdlpnsfatapanmkaydlak
    ytpekmatmasapenvavqysvdpnfwakhakwaseaydnvrlsrhhhhhh
    

    Sequence, based on observed residues (ATOM records):
    >5l9iB (B:)
    hmdvviassgggwqeaqdkalwapaakalnitytqdtfqnwaearaqvesgsvtwdiiqi
    giadepqakaagvlekldpdivnkadfppgsvtdsfvansnystliawnkktygdngpks
    madffdvkkfpgkralwnqpigmieaaalalgtprdkvyeflsteegrkaaiakltelap
    svsvwwesgaqaaqlikdgevdmiitwggrvqgaindganfaytfndaqlgtdgyaivkg
    aphrdaamrflkemskaeyqkdlpnsfatapanmkaydlakytpekmatmasapenvavq
    ysvdpnfwakhakwaseaydnvrls