PDB entry 5l9h

View 5l9h on RCSB PDB site
Description: Crystal structure of T. brucei PDE-B1 catalytic domain with inhibitor NPD-340
Class: hydrolase
Keywords: parasitic PDE, African Trypanosomiasis, sleeping sickness, hydrolase
Deposited on 2016-06-10, released 2018-03-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-03-14, with a file datestamp of 2018-03-09.
Experiment type: XRAY
Resolution: 2.25 Å
R-factor: N/A
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: phosphodiesterase
    Species: Trypanosoma brucei [TaxId:5691]
    Gene: PDEB1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5l9ha_
  • Chain 'B':
    Compound: phosphodiesterase
    Species: Trypanosoma brucei [TaxId:5691]
    Gene: PDEB1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5l9hb_
  • Heterogens: ZN, MG, GOL, FMT, CVL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5l9hA (A:)
    gshmaselnehratlfnknvpsravkrvtaitkvereavlvcelpsfdvtdvefdlfrar
    estdkpldvaaaiayrlllgsglpqkfgcsdevllnfilqcrkkyrnvpyhnfyhvvdvc
    qtihtflyrgnvyekltelecfvllitalvhdldhmglnnsfylktesplgilssasgnt
    svlevhhcnlaveilsdpesdvfdglegaertlafrsmidcvlatdmakhgsaleaflas
    aadqssdeaafhrmtmeiilkagdisnvtkpfdisrqwamavteefyrqgdmekergvev
    lpmfdrsknmelakgqigfidfvaapffqkivdaclqgmqwtvdriksnraqwervletr
    

    Sequence, based on observed residues (ATOM records): (download)
    >5l9hA (A:)
    vtaitkvereavlvcelpsfdvtdvefdlfrarestdkpldvaaaiayrlllgsglpqkf
    gcsdevllnfilqcrkkyrnvpyhnfyhvvdvcqtihtflyrgnvyekltelecfvllit
    alvhdldhmglnnsfylktesplgilssasgntsvlevhhcnlaveilsdpesdvfdgle
    gaertlafrsmidcvlatdmakhgsaleaflasaadqssdeaafhrmtmeiilkagdisn
    vtkpfdisrqwamavteefyrqgdmekergvevlpmfdrsknmelakgqigfidfvaapf
    fqkivdaclqgmqwtvdriksnraqwervletr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5l9hB (B:)
    gshmaselnehratlfnknvpsravkrvtaitkvereavlvcelpsfdvtdvefdlfrar
    estdkpldvaaaiayrlllgsglpqkfgcsdevllnfilqcrkkyrnvpyhnfyhvvdvc
    qtihtflyrgnvyekltelecfvllitalvhdldhmglnnsfylktesplgilssasgnt
    svlevhhcnlaveilsdpesdvfdglegaertlafrsmidcvlatdmakhgsaleaflas
    aadqssdeaafhrmtmeiilkagdisnvtkpfdisrqwamavteefyrqgdmekergvev
    lpmfdrsknmelakgqigfidfvaapffqkivdaclqgmqwtvdriksnraqwervletr
    

    Sequence, based on observed residues (ATOM records): (download)
    >5l9hB (B:)
    rvtaitkvereavlvcelpsfdvtdvefdlfrarestdkpldvaaaiayrlllgsglpqk
    fgcsdevllnfilqcrkkyrnvpyhnfyhvvdvcqtihtflyrgnvyekltelecfvlli
    talvhdldhmglnnsfylktesplgilssasgntsvlevhhcnlaveilsdpesdvfdgl
    egaertlafrsmidcvlatdmakhgsaleaflasaadqssdeaafhrmtmeiilkagdis
    nvtkpfdisrqwamavteefyrqgdmekergvevlpmfdrsknmelakgqigfidfvaap
    ffqkivdaclqgmqwtvdriksnraqwervletr