PDB entry 5l99

View 5l99 on RCSB PDB site
Description: Crystal Structure of BAZ2B bromodomain in complex with 3-amino-2-methylpyridine derivative 6
Class: transcription
Keywords: four helical bundle, transcription
Deposited on 2016-06-09, released 2016-10-26
The last revision prior to the SCOPe 2.06 freeze date was dated 2016-10-26, with a file datestamp of 2016-10-21.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Bromodomain adjacent to zinc finger domain protein 2B
  Species: Homo sapiens [TaxId:9606]
  Gene: BAZ2B, KIAA1476
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q9UIF8 (2-115)
    • expression tag (0-1)
  Domains in SCOPe 2.06: d5l99a1, d5l99a2
• Heterogens: 6S0, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >5l99A (A:)
  smsvkkpkrddskdlalcsmiltemethedawpfllpvnlklvpgykkvikkpmdfstir
  eklssgqypnletfaldvrlvfdncetfneddsdigraghnmrkyfekkwtdtfkv