PDB entry 5l95

View 5l95 on RCSB PDB site
Description: crystal structure of human uba5 in complex with ufm1 and amp
Deposited on 2016-06-09, released 2016-09-21
The last revision was dated 2016-10-05, with a file datestamp of 2016-09-30.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: N/A
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ubiquitin-like modifier-activating enzyme 5
    Species: Homo sapiens [TaxId:9606]
    Gene: UBA5, UBE1DC1
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Ubiquitin-like modifier-activating enzyme 5
    Species: Homo sapiens [TaxId:9606]
    Gene: UBA5, UBE1DC1
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: Ubiquitin-fold Modifier 1
    Species: Homo sapiens [TaxId:9606]
    Gene: UFM1, C13orf20, BM-002
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: Ubiquitin-fold Modifier 1
    Species: Homo sapiens [TaxId:9606]
    Gene: UFM1, C13orf20, BM-002
    Database cross-references and differences (RAF-indexed):
  • Heterogens: AMP, ZN, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >5l95A (A:)
    yekirtfavaivgvggvgsvtaemltrcgigklllfdydkvelanmnrlffqphqaglsk
    vqaaehtlrninpdvlfevhnynittvenfqhfmdrisnggleegkpvdlvlscvdnfea
    rmtintacnelgqtwmesgvsenavsghiqliipgesacfacapplvvaanidektlkre
    gvcaaslpttmgvvagilvqnvlkfllnfgtvsfylgynamqdffptmsmkpnpqcddrn
    crkqqeeykkkvaalpkqeviqeeeeiihednewgielv
    

    Sequence, based on observed residues (ATOM records):
    >5l95A (A:)
    yekirtfavaivgvggvgsvtaemltrcgigklllfdydkvelffqphqaglskvqaaeh
    tlrninpdvlfevhnynittvenfqhfmdrisnggleegkpvdlvlscvdnfearmtint
    acnelgqtwmesgvsenavsghiqliipgesacfacapplvvaanidektslpttmgvva
    gilvqnvlkfllnfgtvsfylgynamqdffptmsmkpnpqcddrncrkqqeeykkkvaal
    peiihednewgielv
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >5l95B (B:)
    yekirtfavaivgvggvgsvtaemltrcgigklllfdydkvelanmnrlffqphqaglsk
    vqaaehtlrninpdvlfevhnynittvenfqhfmdrisnggleegkpvdlvlscvdnfea
    rmtintacnelgqtwmesgvsenavsghiqliipgesacfacapplvvaanidektlkre
    gvcaaslpttmgvvagilvqnvlkfllnfgtvsfylgynamqdffptmsmkpnpqcddrn
    crkqqeeykkkvaalpkqeviqeeeeiihednewgielv
    

    Sequence, based on observed residues (ATOM records):
    >5l95B (B:)
    yekirtfavaivgvggvgsvtaemltrcgigklllfdydglskvqaaehtlrninpdvlf
    evhnynittvenfqhfmdrisnggleegkpvdlvlscvdnfearmtintacnelgqtwme
    sgvsenavsghiqliipgesacfacapplvvaanidekslpttmgvvagilvqnvlkfll
    nfgtvsfylgynamqdffptmsmkpnpqcddrncrkqqeeykkkvaalhednewgielv
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records:
    >5l95C (C:)
    vsfkitltsdprlpykvlsvpestpftavlkfaaeefkvpaatsaiitndgiginpaqta
    gnvflkhgselriiprdrvg
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records:
    >5l95D (D:)
    vsfkitltsdprlpykvlsvpestpftavlkfaaeefkvpaatsaiitndgiginpaqta
    gnvflkhgselriiprdrvg