PDB entry 5l8y

View 5l8y on RCSB PDB site
Description: Crystal structure of T. brucei PDE-B1 catalytic domain with inhibitor NPD-937
Class: hydrolase
Keywords: parasitic PDE, African Trypanosomiasis, sleeping sickness, hydrolase
Deposited on 2016-06-08, released 2018-03-14
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-05-23, with a file datestamp of 2018-05-18.
Experiment type: XRAY
Resolution: 2.14 Å
R-factor: N/A
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: phosphodiesterase
    Species: Trypanosoma brucei [TaxId:5691]
    Gene: PDEB1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d5l8ya_
  • Chain 'B':
    Compound: phosphodiesterase
    Species: Trypanosoma brucei [TaxId:5691]
    Gene: PDEB1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d5l8yb_
  • Heterogens: ZN, MG, FMT, GAI, GOL, CVA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5l8yA (A:)
    gshmaselnehratlfnknvpsravkrvtaitkvereavlvcelpsfdvtdvefdlfrar
    estdkpldvaaaiayrlllgsglpqkfgcsdevllnfilqcrkkyrnvpyhnfyhvvdvc
    qtihtflyrgnvyekltelecfvllitalvhdldhmglnnsfylktesplgilssasgnt
    svlevhhcnlaveilsdpesdvfdglegaertlafrsmidcvlatdmakhgsaleaflas
    aadqssdeaafhrmtmeiilkagdisnvtkpfdisrqwamavteefyrqgdmekergvev
    lpmfdrsknmelakgqigfidfvaapffqkivdaclqgmqwtvdriksnraqwervletr
    

    Sequence, based on observed residues (ATOM records): (download)
    >5l8yA (A:)
    vtaitkvereavlvcelpsfdvtdvefdlfrarestdkpldvaaaiayrlllgsglpqkf
    gcsdevllnfilqcrkkyrnvpyhnfyhvvdvcqtihtflyrgnvyekltelecfvllit
    alvhdldhmglnnsfylktesplgilssasgntsvlevhhcnlaveilsdpesdvfdgle
    gaertlafrsmidcvlatdmakhgsaleaflasaadqssdeaafhrmtmeiilkagdisn
    vtkpfdisrqwamavteefyrqgdmekergvevlpmfdrsknmelakgqigfidfvaapf
    fqkivdaclqgmqwtvdriksnraqwervletr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5l8yB (B:)
    gshmaselnehratlfnknvpsravkrvtaitkvereavlvcelpsfdvtdvefdlfrar
    estdkpldvaaaiayrlllgsglpqkfgcsdevllnfilqcrkkyrnvpyhnfyhvvdvc
    qtihtflyrgnvyekltelecfvllitalvhdldhmglnnsfylktesplgilssasgnt
    svlevhhcnlaveilsdpesdvfdglegaertlafrsmidcvlatdmakhgsaleaflas
    aadqssdeaafhrmtmeiilkagdisnvtkpfdisrqwamavteefyrqgdmekergvev
    lpmfdrsknmelakgqigfidfvaapffqkivdaclqgmqwtvdriksnraqwervletr
    

    Sequence, based on observed residues (ATOM records): (download)
    >5l8yB (B:)
    vtaitkvereavlvcelpsfdvtdvefdlfrarestdkpldvaaaiayrlllgsglpqkf
    gcsdevllnfilqcrkkyrnvpyhnfyhvvdvcqtihtflyrgnvyekltelecfvllit
    alvhdldhmglnnsfylktesplgilssasgntsvlevhhcnlaveilsdpesdvfdgle
    gaertlafrsmidcvlatdmakhgsaleaflasaadqssdeaafhrmtmeiilkagdisn
    vtkpfdisrqwamavteefyrqgdmekergvevlpmfdrsknmelakgqigfidfvaapf
    fqkivdaclqgmqwtvdriksnraqwervlet