PDB entry 5l8x

View 5l8x on RCSB PDB site
Description: x-ray structure of apo methanocaldococcus jannaschii methyltransferase subunit a at 1.85 angstrom
Deposited on 2016-06-08, released 2016-06-22
The last revision was dated 2016-09-28, with a file datestamp of 2016-09-23.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: N/A
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Tetrahydromethanopterin S-methyltransferase subunit A
    Species: Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) [TaxId:243232]
    Gene: mtrA, MJ0851
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q58261 (2-171)
      • expression tag (0-1)
  • Chain 'B':
    Compound: Tetrahydromethanopterin S-methyltransferase subunit A
    Species: Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) [TaxId:243232]
    Gene: mtrA, MJ0851
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q58261 (3-End)
      • expression tag (0-2)
  • Heterogens: LMR, MLT, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >5l8xA (A:)
    shmankrepapgwpivsgeyvvgnpescvgvvtlgshgleqacidagaaiagpchtenlg
    iekvvanyisnpnirfmilcgsevqghitgqcfkalwengigddggiigakgaipflenv
    nkeaverfrrqivevvdlidcedigkitqaikeclskdpgaidedpfiiele
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >5l8xB (B:)
    gshmankrepapgwpivsgeyvvgnpescvgvvtlgshgleqacidagaaiagpchtenl
    giekvvanyisnpnirfmilcgsevqghitgqcfkalwengigddggiigakgaipflen
    vnkeaverfrrqivevvdlidcedigkitqaikeclskdpgaidedpfiiele
    

    Sequence, based on observed residues (ATOM records):
    >5l8xB (B:)
    gshmankrepapgwpivsgeyvvgnpescvgvvtlgshgleqacidagaaiagpchtenl
    giekvvanyisnpnirfmilcgsevqghitgqcfkalwengigddggiigakgaipflen
    vnkeaverfrrqivevvdlidcedigkitqaikeclskdpgaidedpfiiel