PDB entry 5l8v

View 5l8v on RCSB PDB site
Description: apo-structure of humanised rada-mutant humrada4
Deposited on 2016-06-08, released 2016-10-19
The last revision was dated 2016-11-30, with a file datestamp of 2016-11-25.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: N/A
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: DNA repair and recombination protein radA
    Species: Pyrococcus furiosus [TaxId:186497]
    Gene: radA, PF1926
    Database cross-references and differences (RAF-indexed):
    • Uniprot O74036 (1-225)
      • engineered mutation (62)
      • engineered mutation (94-95)
      • engineered mutation (112-115)
      • engineered mutation (118-121)
  • Heterogens: PO4, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >5l8vA (A:)
    matigristgsksldkllgggietqaitevfgefgsgktqlahtlavmvqlppeegglng
    svmwidtentfrperireiaqnrgldpdevlkhiayarafnsnhqmllvqqasammkesr
    yallivdsltshfrseyigrgalaerqqklakhladlhrlanlydiavfvtnqvqanggh
    ilahsatlrvylrkgkggkriarlidaphlpegeavfsitekgied
    

    Sequence, based on observed residues (ATOM records):
    >5l8vA (A:)
    atigristgsksldkllgggietqaitevfgefgsgktqlahtlavmvqlppeegglngs
    vmwidtentfrperireiaqnrgldpdevlkhiayarafnsnhqmllvqqasammkesry
    allivdsltshfrseyigrgalaerqqklakhladlhrlanlydiavfvtnqvqgghila
    hsatlrvylrkgkggkriarlidaphlpegeavfsitekgied